DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and SEC14L6

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:316 Identity:59/316 - (18%)
Similarity:107/316 - (33%) Gaps:105/316 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPQIRPLTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLE 65
            ||.|:..|:|..:|    .|.:..|.::..|.|.           |..||.||:.:|:...:.|:
Human     4 MSGQVGDLSPSQEK----SLAQFRENIQDVLSAL-----------PNPDDYFLLRWLQARSFDLQ 53

  Fly    66 RAKSKLDKYYTLKTKY------------------------------PDYFRVTNTTDSK------ 94
            :::..|.|:...:.:.                              |.::.:..:.|.|      
Human    54 KSEDMLRKHMEFRKQQDLANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSA 118

  Fly    95 ---------FR---------EIHQ--------TGAIIYLPTPLNENGP-RIGIWRMGLVPVEKYT 132
                     ||         |:..        ||    :..||:..|. ...||    .|::::.
Human   119 SKQELLRDSFRSCELLLRECELQSQKPHWTRGTG----ISAPLDRRGNCNTAIW----PPMDRHK 175

  Fly   133 MLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLK 197
            .|.                  ..|..::.|..::|.....|::....:.::|....|...|..||
Human   176 ELG------------------KRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILK 222

  Fly   198 AQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHG-NKMGLLTEQIPLKYLPEEYGG 252
            :...:.....|...||:.|..||::.:.::.:.| |....||:.|....||.|:||
Human   223 SLIVVRAPKLFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVEFGG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 10/45 (22%)
SEC14 97..253 CDD:238099 35/166 (21%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.