DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and Sec14l5

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001121197.1 Gene:Sec14l5 / 665119 MGIID:3616084 Length:696 Species:Mus musculus


Alignment Length:320 Identity:54/320 - (16%)
Similarity:109/320 - (34%) Gaps:85/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKEQLKEDPERLEAD----------------LQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSL 64
            |.|....|.::|:||                |...:.|: |:.|......|:.::.|||...:.|
Mouse   215 ASEMAIADGDKLDADYIERCLGHLSPMQESCLVQLRHWL-QETHKGKIPKDEHILRFLRARDFHL 278

  Fly    65 ERAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYL---PTPLNE-----------NG 115
            ::|:..|                  .....:|:.||...::..   |.||.|           :|
Mouse   279 DKARDML------------------CQSLSWRKQHQVDLLLQTWRPPPPLQEFYAGGWHYQDIDG 325

  Fly   116 PRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYA------------------NVNGVVFI 162
            ..:.|.|:|        .::...:.:|:.|.|:|:...:                  .::....:
Mouse   326 RPLYILRLG--------QMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCL 382

  Fly   163 MDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRL 227
            :|::|....||::.......:.....|:..|..|.....:.....|..|:.:..|.:::..:.:.
Mouse   383 LDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKF 447

  Fly   228 FVHGNK----MGLLTEQIPLKYLPEEYGGENGTTQDIVAAMEKKL------DEYADFFQE 277
            .::...    .|.|.:.:....:|:..|||:.........:.|.|      .|.||..|:
Mouse   448 LIYSGSNYQGPGGLVDYLDKDVIPDFLGGESVCNVPEGGMVPKSLYLTEEEQEQADQLQQ 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 13/61 (21%)
SEC14 97..253 CDD:238099 28/191 (15%)
Sec14l5NP_001121197.1 PRELI 17..173 CDD:368069
CRAL_TRIO_N 243..288 CDD:215024 11/63 (17%)
SEC14 306..479 CDD:214706 28/180 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.