DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:273 Identity:63/273 - (23%)
Similarity:113/273 - (41%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPQIRPLTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLE 65
            ||.::..|:|:    ..|.|.:..|.::..|.|.           |..||.||:.:||...:.|:
  Rat     1 MSGRVGDLSPK----QAETLAKFRENVQDVLPAL-----------PNPDDYFLLRWLRARNFDLQ 50

  Fly    66 RAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLP------------------TPLN 112
            ::::.|.||...: |..|   :.:..|.:..|:.|.    |:|                  .||:
  Rat    51 KSEAMLRKYMEFR-KTMD---IDHILDWQPPEVIQK----YMPGGLCGYDRDGCPLWYDIIGPLD 107

  Fly   113 ENGPRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYA-NVNGVVFIMDMKGATAAHLFQM 176
            ..|....:.:..|:   |..|.:|.::   :.|..:..:... .:..:|.|.|.:|....|.::.
  Rat   108 PKGLLFSVTKQDLL---KTKMRDCERI---LHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKP 166

  Fly   177 TPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGN--KMGLLTE 239
            ...:.::|....||..|..||....:.....|...:|:.||.:|:..:.::.|.||  |.||| :
  Rat   167 LVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWKEGLL-K 230

  Fly   240 QIPLKYLPEEYGG 252
            .|..:.||..:||
  Rat   231 LISPEELPAHFGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 11/45 (24%)
SEC14 97..253 CDD:238099 40/177 (23%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 14/56 (25%)
SEC14 76..245 CDD:214706 40/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.