DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and sec14l8

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:229 Identity:50/229 - (21%)
Similarity:101/229 - (44%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PRMDDQFLVAFLRGCKYSLERAKSKLDKYYTLKTKYPDYFRV-TNTTDSKFREIHQTGAIIYLPT 109
            |...|.||:.:||...::|:::::.|.|:    .::..:.:| |.||:.:..|:...    ||..
Zfish    31 PSQSDHFLLRWLRARNFNLQKSEAMLRKH
----IEFRKHMKVDTITTEWQVPEVIDK----YLSG 87

  Fly   110 PL----NENGPRIGIWRMGLVPVEKYTMLECMQ----VAQAMQEIAILEDDY--------ANVNG 158
            .:    .|..|   :|...:.|::...::....    :...:::..||:.|.        .|:..
Zfish    88 GMCGHDREGSP---VWYDVIGPLDPKGLMHSASKQDLIKSKVRDCEILQKDCDRQSERLGRNIES 149

  Fly   159 VVFIMDMKGATAAHLFQMTPSM---AKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMS 220
            :..:.|.:|....||::  |::   .:..|:| |:..|..||....|.....|...:|:.|..:|
Zfish   150 ITMVYDCEGLGMKHLYK--PAIETYGEVLTMF-EDNYPEGLKRLFVIKAPKLFPVAYNLVKHFLS 211

  Fly   221 KKMQSRLFVHG-NKMGLLTEQIPLKYLPEEYGGE 253
            :..:.::.|.| |...:|.:.|..:.||..|||:
Zfish   212 EDTRRKVIVLGSNWQEVLQKYIDPEELPAYYGGK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 8/27 (30%)
SEC14 97..253 CDD:238099 36/175 (21%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 8/27 (30%)
SEC14 78..246 CDD:214706 37/178 (21%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.