DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CG11550

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:300 Identity:83/300 - (27%)
Similarity:149/300 - (49%) Gaps:13/300 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKLDKYYTLKTKY 81
            ::|....||....::..|..||..|||::.|..:...:.|...|:||:|.||..||...|.:|..
  Fly     7 EDQYASFPEIRRPEVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHL 71

  Fly    82 PDYFRVTNTTDSKFREIHQTGAIIYLP--TPLNENGPRIGIWRMGLVPVEKYTMLECMQVAQAMQ 144
            .::|...:....:.|...:|.:|:.||  ||   .|.|:.:.::..:....|...:.|::...:.
  Fly    72 EEFFVNLDCERPEIRRAMRTVSIVPLPGATP---EGYRVILAKLDDLNTSNYNFADVMKLYCMVF 133

  Fly   145 EIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQHFINTITGFE 209
            :..:.||...  .|.|.::|:|..:..|:.::.....|||..:.:||..:||...||||.:...:
  Fly   134 DFWMYEDGIQ--PGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMD 196

  Fly   210 QLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGG---ENGTTQDIVAAMEKKLDEY 271
            ::..:..|.|.|::.:.|.:|.: :....:.:|.:.||:||||   |....::|.  .:|.||..
  Fly   197 KILALMTPFMKKELTTVLHMHSD-LKEFYKFVPQEMLPKEYGGQLEEANVAKEIY--YKKLLDNR 258

  Fly   272 ADFFQENVNFGTDESLRPGKPIDFEGLFGVEGSFRKLNVD 311
            .:..:.......:|.|||||..:...|||:||:|:||::|
  Fly   259 KEMIEFETRHQVNEKLRPGKAKNASDLFGIEGNFKKLDID 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 16/45 (36%)
SEC14 97..253 CDD:238099 40/160 (25%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.