DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CG10301

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster


Alignment Length:306 Identity:100/306 - (32%)
Similarity:165/306 - (53%) Gaps:2/306 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPLTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSK 70
            |||:|.|.|:|::::.|.|:|::.|:...:.||.|||||..|.|..||:||||.|:||||..|.:
  Fly     3 RPLSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRR 67

  Fly    71 LDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPVEKYTMLE 135
            :|:|:|....:|:... ......:..:|::.|..:|...|..::...:.|.|.|......|.:.|
  Fly    68 IDRYFTHYNLFPEIMN-NRCVTQRLLDINRMGVCLYPDMPKGDSRSAMFIARFGHFDPNLYMLRE 131

  Fly   136 CMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQH 200
            ....:....|:..||:|||::.|:..|:|::|..:..:.:....:.:|:..:.....||::|..:
  Fly   132 IYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMY 196

  Fly   201 FINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGENGTTQDIVAAME 265
            .||.....:........::|.::...:.|..|...|: |.|..:.|||||||.||...:.||.||
  Fly   197 IINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELI-EHIGKESLPEEYGGTNGHLGECVAYME 260

  Fly   266 KKLDEYADFFQENVNFGTDESLRPGKPIDFEGLFGVEGSFRKLNVD 311
            ..|:.|..:|:::.|:||.|.||.|:...:|..||..||||:||.|
  Fly   261 DLLNSYRGYFEQDCNYGTIEELRHGEIATYEAEFGANGSFRRLNWD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 23/45 (51%)
SEC14 97..253 CDD:238099 37/155 (24%)
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 23/45 (51%)
CRAL_TRIO 114..248 CDD:279044 33/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.