DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and pinta

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster


Alignment Length:256 Identity:67/256 - (26%)
Similarity:121/256 - (47%) Gaps:10/256 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKLDKYYTLKTKYPDYFRV 87
            ||||:.|.:|....|:...|.:|.....:.|..|||..|:.:||||.||..:|.::.:..::|  
  Fly    18 DPERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWF-- 80

  Fly    88 TNTTDSKFREIHQTGAI-IYLPTPLNENGPRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILED 151
             :..|.:..||.....: ::||...:.....:.:.|......:.::.....:.::.:.::.:..|
  Fly    81 -DNRDPQLPEIQDLLKLGVFLPIGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLD 144

  Fly   152 DYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFK 216
            ......|:|.|:||:|....|..||.|.:.|: :|.|..|.|.:.|...|.|.........|.|:
  Fly   145 PETCARGMVAILDMQGVQLGHALQMNPKLIKR-SVESWTAYPCQPKLLEFTNAPRHVNFFLNTFR 208

  Fly   217 PMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGENGTTQDIVAAMEKKLDEYADFFQE 277
            ..|:.|::|||||......:..:|     ||:|.||:..:..::....::.::|.|||:.|
  Fly   209 IFMTPKIRSRLFVRREGTSVSCDQ-----LPKELGGQGLSYMELSVKWKQLVEENADFYVE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 16/45 (36%)
SEC14 97..253 CDD:238099 38/156 (24%)
pintaNP_001287466.1 SEC14 87..240 CDD:238099 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.