DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and rlbp1b

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:268 Identity:69/268 - (25%)
Similarity:121/268 - (45%) Gaps:25/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRM-----------DDQFLVAFLRGCKYSLE 65
            :|| ||::|.|..|:..:.::..:..|:::......:           .|..||.|:|..||.:.
Zfish    45 MQK-AKDELNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVN 108

  Fly    66 RAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNEN---GPRIGIWRMGLVP 127
            ||...:..|...:..||:.|.  |.|....|...:.|    .|..|:..   |..:.::.:....
Zfish   109 RAYELMKGYVRFRRDYPELFE--NLTPEAVRSTIEAG----YPGILSSRDKYGRVVLLFNIENWD 167

  Fly   128 VEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEAL 192
            .|:.|..|.::....:.| .:||::...:||...|.:.||.|......:.|:..||.....:::.
Zfish   168 YEEITFDEILRAYCVILE-KLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDMLQDSF 231

  Fly   193 PLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGENGTT 257
            |.|.||.|||:....|...:|:.||:|..|:..|:||||:.:....::...:.||.::.|: |:.
Zfish   232 PARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDAEILPSDFDGK-GSK 295

  Fly   258 QD--IVAA 263
            .|  |.||
Zfish   296 YDGKITAA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 10/56 (18%)
SEC14 97..253 CDD:238099 39/158 (25%)
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 10/56 (18%)
CRAL_TRIO 143..292 CDD:279044 39/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.