DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CG33523

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:98 Identity:15/98 - (15%)
Similarity:37/98 - (37%) Gaps:33/98 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPELQKVAKEQLKEDPE--RLEADLQA-FKTWIEQQPHLNPRMDDQFLVAFLRG---------- 59
            :|.::|..:.|:.:..|.  .::.:.:| ...|::.:..|:....|:|||..:..          
  Fly   323 VTYKIQTTSPEKFRVRPRCGIIQPNQEATINIWLKSEHKLSDDSKDKFLVMAMVAPGGECGGADV 387

  Fly    60 --------------------CKYSLERAKSKLD 72
                                |::...::|::||
  Fly   388 TELWRSKSPTSADVEQHRLVCRFDENKSKAQLD 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 11/76 (14%)
SEC14 97..253 CDD:238099
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 11/72 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.