DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CG32407

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:271 Identity:48/271 - (17%)
Similarity:95/271 - (35%) Gaps:78/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PERLEADLQAFKTWIEQQPHLNP-------RMDDQ--FLVAFLRGCKYSLERAKSKL-DKYYTLK 78
            ||::.....:....:|::|...|       |:.|.  ::...|:...:.:|:..::| |.....|
  Fly     9 PEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRK 73

  Fly    79 TKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPVEKYTMLECMQVAQAM 143
            :     |.|.:.|::...:.......||:.....:..|.:      ::.::|::       ....
  Fly    74 S-----FGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLL------ILTIKKHS-------KSRN 120

  Fly   144 QE---------IAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQ 199
            ||         |..|:.| :|::.:...|||.||..::|                        ..
  Fly   121 QEDLLRILVFWIERLQRD-SNLDKITIFMDMTGAGLSNL------------------------DM 160

  Fly   200 HFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPL--KYLPEEYGGENGTTQDIVA 262
            .||.:|.|..:....:.|       :.:.||.... ||.....|  .:||.|      ..:.:..
  Fly   161 GFIKSIIGVFETKYPYVP-------NYILVHDLPF-LLDAAFKLVKTFLPPE------ALKILKV 211

  Fly   263 AMEKKLDEYAD 273
            ..:|.:|:|.|
  Fly   212 TTKKDIDQYVD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 9/55 (16%)
SEC14 97..253 CDD:238099 29/166 (17%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 33/183 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.