DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CG13893

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:354 Identity:81/354 - (22%)
Similarity:124/354 - (35%) Gaps:107/354 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKLDKYYTLKTKYPDY 84
            |.|..|...|.|:.|:..::..  |....||.|||.:||..|::||.|:..|..  :|||:  ..
  Fly     5 LPEISEEQRAILEKFRKQMDDA--LVGTHDDYFLVRWLRARKWNLEAAEKMLRA--SLKTR--AM 63

  Fly    85 FRVTN----TTDSKFREIHQTGAIIYLPTPL----NENGP-------RIGIWRM----GLVPVEK 130
            :.|.|    ......:|        |||..|    ||..|       ...:|.|    .....:|
  Fly    64 WNVDNIEKWDPPKALQE--------YLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQK 120

  Fly   131 YTMLECMQVAQAMQEIAILEDDYANVNG-----VVFIMDMKGATAAHLFQMTP------SMAKKF 184
            |.:|    :.:...:||.   |.:..:|     :|...||:...... :...|      |..|::
  Fly   121 YLVL----LLERFMKIAY---DQSQKHGWRARQLVVFFDMQDVNLKQ-YAWRPAAECVISTVKQY 177

  Fly   185 TVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQ----IPLKY 245
                |...|..||..:.||....|...||:.|..:.:...|::.::.:.:....||    :..|.
  Fly   178 ----EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKA 238

  Fly   246 LPEEYGGE----NGTTQ--------------------------DIVAAMEKKLDEYADFFQENV- 279
            .|:.:|||    ||..|                          |.|.|...|.|:....|:.|| 
  Fly   239 FPKAWGGEMVDRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRDFVEAQVPKGDKLKLHFKVNVE 303

  Fly   280 -------NFGTDESLRPGKPIDFEGLFGV 301
                   .|.|         .|::..||:
  Fly   304 EQKILSWEFRT---------FDYDIKFGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 16/45 (36%)
SEC14 97..253 CDD:238099 39/185 (21%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 15/44 (34%)
SEC14 75..246 CDD:238099 39/190 (21%)
GOLD_2 303..381 CDD:290608 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.