DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:274 Identity:62/274 - (22%)
Similarity:113/274 - (41%) Gaps:52/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPQIRPLTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLE 65
            ||.::..|:|:    ..|.|.:..|.::..|.|.           |..||.||:.:||...:.|:
Mouse     1 MSGRVGDLSPK----QAETLAKFRENVQDVLPAL-----------PNPDDYFLLRWLRARNFDLQ 50

  Fly    66 RAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLP------------------TPLN 112
            ::::.|.||...: |..|   :.:..|.:..|:.|.    |:|                  .||:
Mouse    51 KSEAMLRKYMEFR-KTMD---IDHILDWQPPEVIQK----YMPGGLCGYDRDGCPVWYDIIGPLD 107

  Fly   113 ENGPRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYA-NVNGVVFIMDMKGATAAHLFQM 176
            ..|....:.:..|:   |..|.:|.::   :.|..:..:... .:..:|.|.|.:|....|.::.
Mouse   108 PKGLLFSVTKQDLL---KTKMRDCERI---LHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKP 166

  Fly   177 TPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGN---KMGLLT 238
            ...:.::|....||..|..||....:.....|...:|:.||.:|:..:.::.|.|:   |.||| 
Mouse   167 LVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLL- 230

  Fly   239 EQIPLKYLPEEYGG 252
            :.|..:.||..:||
Mouse   231 KLISPEELPAHFGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 11/45 (24%)
SEC14 97..253 CDD:238099 39/178 (22%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 14/56 (25%)
SEC14 76..246 CDD:214706 39/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.