DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CG5973

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:309 Identity:90/309 - (29%)
Similarity:149/309 - (48%) Gaps:37/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPQIR---PLTPE-LQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKY 62
            |.|||   ...|| ..|.|:::|:|.|...|..::..:..|:.:.:||..:||::::.|||...|
  Fly    21 SAQIRMEKEQAPEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHY 85

  Fly    63 SLERAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGI------W 121
            ..|.|..:|..:|.:|.||.  ....|...||.|.:.:...:..|| ..:::|.|:.:      |
  Fly    86 YPESALKRLKNFYHMKLKYG--AACENIIPSKLRNVFEANILNLLP-QRDQHGRRLLVLEAGKKW 147

  Fly   122 RMGLVP-VEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFT 185
            :...|| |:.:..:: :.|..:|.|      .|:.:.|.|.|:||:|...:|:.|.|||.|....
  Fly   148 KPSQVPLVDLFRGIQ-LTVLGSMVE------PYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLL 205

  Fly   186 VFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEY 250
            .:.:|.:.:||||.|.:|....|..||.:|||.:.:|::.|:|.||.....|...|..|.||.:|
  Fly   206 DYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKY 270

  Fly   251 GGENGTTQDIVAAME----KKLDEYADFFQENV----NFGTDESLRPGK 291
            ||.        |..|    |.|.|:.:.:.::.    ::|..|..:..|
  Fly   271 GGS--------ATWELPHGKVLGEFFECYSKDYELADSYGYTEGYKMKK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 13/45 (29%)
SEC14 97..253 CDD:238099 49/162 (30%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 13/44 (30%)
SEC14 116..272 CDD:238099 49/163 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.