DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and retm

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:296 Identity:63/296 - (21%)
Similarity:95/296 - (32%) Gaps:102/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKL- 71
            :|.||...|..|.....:||.|:        :|..|.|..........|........|..||.| 
  Fly   485 VTAELPTTAAAQALVPGKRLSAN--------QQHDHRNLYKSVDLKAGFAHELLIRNEDPKSVLT 541

  Fly    72 --------DKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPV 128
                    |.::||       :|||.....|     ...|:.|.  .|.:....:..:|      
  Fly   542 WDFDVMRNDLHFTL-------YRVTQELPEK-----NDSAVSYF--DLQDFVEGVNYFR------ 586

  Fly   129 EKYTML----ECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSE 189
            |:.|::    |.:|.:..|..    .|.|                ..|.|  :||.| :..||.|
  Fly   587 EEPTLICRHKESVQGSHVMHH----NDSY----------------LMHWF--SPSGA-QLNVFYE 628

  Fly   190 EALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGEN 254
            .     |.:.::..::|..:..|:. ....:..:|||.:   .|.|              .||.|
  Fly   629 V-----LSSANYKGSMTSLQSAFSS-NSSAASSVQSRXY---EKAG--------------DGGTN 670

  Fly   255 G------TTQDIVAA-------MEKKLD--EYADFF 275
            |      ..::.:||       |||.|:  |..|.|
  Fly   671 GAEWRSPALEEPIAADILTGTLMEKSLNLFETPDVF 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 10/54 (19%)
SEC14 97..253 CDD:238099 28/159 (18%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024
CRAL_TRIO 293..456 CDD:279044
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.