DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CG31826

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:292 Identity:59/292 - (20%)
Similarity:116/292 - (39%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKLD 72
            ||..:...|::..|         ::..:..:|:...|....:|..|..||...::...:|...:.
  Fly     4 LTARVDHTAEQIFK---------IEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIH 59

  Fly    73 KYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWR------------MGL 125
            .||..|.::|.:  |.......:|::.......|:....:.:|..:.:::            ..|
  Fly    60 DYYEFKRRHPTW--VARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSL 122

  Fly   126 VPVEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEE 190
            |.::. .:.|.:.:...:|:           ||:..|.|::|.....|.|.:|:..|   |.:|:
  Fly   123 VEMDD-LIFESLLLLPRVQQ-----------NGITVICDLQGTNRNFLRQFSPAFMK---VVNEK 172

  Fly   191 --ALPLRLKAQHFINTITGF--EQLFNMFKPMMSKKMQSRLFVH-GNKMGLLTEQIPLKYLPEEY 250
              .||...:..|.|.  .||  .....:|.|.|:|:.:.::|.| |..:..|.|.:..:.||.||
  Fly   173 NGVLPFSQRIVHIIQ--RGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEY 235

  Fly   251 GGENGTTQDIVAAMEKKLDEYADFFQENVNFG 282
            ||......| ...:...|.:.|::.::...:|
  Fly   236 GGPATNVLD-TNLIFNHLSQNAEYLEKLQTYG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 7/45 (16%)
SEC14 97..253 CDD:238099 37/172 (22%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 8/52 (15%)
CRAL_TRIO 92..237 CDD:279044 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.