DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and Sec14l5

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:291 Identity:48/291 - (16%)
Similarity:101/291 - (34%) Gaps:79/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKEQLKEDPERLEAD----------------LQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSL 64
            |.|....|.::|:||                |...:.|: |:.|......|:.::.|||...:.|
  Rat   215 ASEMATADGDKLDADYIERCLGHLSPMQESCLVQLRRWL-QETHKGKIPKDEHILRFLRARDFHL 278

  Fly    65 ERAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYL---PTPLNE-----------NG 115
            ::|:..|                  .....:|:.||...::..   |.||.|           :|
  Rat   279 DKARDML------------------CQSLSWRKQHQVDLLLQTWRPPAPLQEFYAGGWHYQDIDG 325

  Fly   116 PRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYA------------------NVNGVVFI 162
            ..:.|.|:|        .::...:.:|:.|.|:|:...:                  .::....:
  Rat   326 RPLYILRLG--------QMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCL 382

  Fly   163 MDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRL 227
            :|::|....||::.......:.....|:..|..|.....:.....|..|:.:..|.:::..:.:.
  Rat   383 LDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKF 447

  Fly   228 FVHGNK----MGLLTEQIPLKYLPEEYGGEN 254
            .::...    .|.|.:.:....:|:..|||:
  Rat   448 LIYSGSNYQGPGGLVDYLDKDVIPDFLGGES 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 13/61 (21%)
SEC14 97..253 CDD:238099 28/191 (15%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 21/112 (19%)
CRAL_TRIO_N 243..288 CDD:215024 11/63 (17%)
CRAL_TRIO 314..477 CDD:306996 22/170 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.