DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and C34C12.6

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:156 Identity:29/156 - (18%)
Similarity:66/156 - (42%) Gaps:14/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 MLECMQVAQAMQEIAILED-----DYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSE--- 189
            :|.|...::.:|::.:..:     |...|..:| |.|:................|.:.:.||   
 Worm   138 LLHCFGYSEMLQQLILRREKKQSADKGPVQFIV-IFDLNTVNITDYVNPMSGYMKLWQIRSELWQ 201

  Fly   190 EALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGEN 254
            :..|..::..:..|.......|:.:.:..:|::...|:.:..:|..|..:.:|...:|:|||||.
 Worm   202 DWFPEMVQRIYLTNPPRLLGLLWKVARVFLSEENLKRIEIISDKSDLAGKFLPPWLVPKEYGGEF 266

  Fly   255 GTT----QDIVAAMEKKLDEYADFFQ 276
            ..|    .:...::.:|:.. ||:::
 Worm   267 VNTVPPGDETGVSVRRKITS-ADYYK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024
SEC14 97..253 CDD:238099 23/127 (18%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 23/127 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.