DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and CLVS2

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens


Alignment Length:299 Identity:81/299 - (27%)
Similarity:139/299 - (46%) Gaps:25/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLN-PRMDDQFLVAFLRGCKYSLERAKSKL 71
            |:||..:.|:.:|.|:|:.|..|:|..:..:..:|.:. .|.||.|::.|||..|:....|...|
Human     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72

  Fly    72 DKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLP---TPLNENGPRIGIWRMGLVPVEKYTM 133
            .:|:..:.:..|.|:....||...::..:.|    .|   ..|:..|.:|.:.........:||:
Human    73 AQYFEYRQQNLDMFKSFKATDPGIKQALKDG----FPGGLANLDHYGRKILVLFAANWDQSRYTL 133

  Fly   134 LECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKA 198
            ::.::......| |::||....|||.|.|:|....|.....::||||.:......:::.|.|...
Human   134 VDILRAILLSLE-AMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGG 197

  Fly   199 QHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGG-----ENGTTQ 258
            .||:|.......|:.:.:|.:.:|.:.|:|:|||.:..|.:.|..:.||.|:||     :.||..
Human   198 IHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWA 262

  Fly   259 DIVAAMEKKLD-EYADFFQENVNFGTDESLRPGKPIDFE 296
            ..:      || ||.|..:.||    |....|.|.::.|
Human   263 RTL------LDHEYDDDSEYNV----DSYSMPVKEVEKE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 13/46 (28%)
SEC14 97..253 CDD:238099 42/163 (26%)
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 106..251 CDD:238099 38/145 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.