DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and LOC1271257

DIOPT Version :10

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_309981.4 Gene:LOC1271257 / 1271257 VectorBaseID:AGAMI1_011467 Length:333 Species:Anopheles gambiae


Alignment Length:34 Identity:8/34 - (23%)
Similarity:17/34 - (50%) Gaps:8/34 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAMTNSIVLLLFSLTFLEHGLLFQRVSSLGINYG 41
            :|...:::||:        ||:....:.:|:|.|
Mosquito     2 LAFLRNLILLI--------GLIAIVAAQVGVNTG 27

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 4/14 (29%)
SEC14 95..253 CDD:469559
LOC1271257XP_309981.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.