DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nab and NAB1

DIOPT Version :9

Sequence 1:NP_001014557.3 Gene:nab / 3346237 FlyBaseID:FBgn0259986 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001308241.1 Gene:NAB1 / 4664 HGNCID:7626 Length:487 Species:Homo sapiens


Alignment Length:341 Identity:133/341 - (39%)
Similarity:182/341 - (53%) Gaps:56/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PGNEAEVQLYRVLQRASLLAYYDTLLEMGGDDVQQLYDAGEEEFLEIMALVGMASKPLHVRRLQK 177
            |....|:||||:||:|:||:|:|..::.||||||||.:|||||||||||||||||||||||||||
Human     6 PRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMASKPLHVRRLQK 70

  Fly   178 ALHEWANNPGLFQGPMMPHLGLCETPPKPALIFNPDTTPALPRQKFPSFNP-----SGSSFMPSP 237
            ||.:|..|||||..|      |...|           ..::|..|.|..:|     |.||:..| 
Human    71 ALRDWVTNPGLFNQP------LTSLP-----------VSSIPIYKLPEGSPTWLGISCSSYERS- 117

  Fly   238 VPPAPLPASASVPAPTVPLATQISCPSA--------------PSVPLPLVLPPNPLTSSPHPSAN 288
                   ::|..|...:|.....:|..:              .||....:...:..|.|.|..:.
Human   118 -------SNAREPHLKIPKCAATTCVQSLGQGKSDVVGSLALQSVGESRLWQGHHATESEHSLSP 175

  Fly   289 SNLPANTAHQVSSSSPQLTPVLTEAQIQRITMCADKIGRQLPQRE----PRAQTTRKRTTRELEQ 349
            ::|.:..:.:.||.:......|:.|:      |.:::...||:.:    .....|.|:..:.:..
Human   176 ADLGSPASPKESSEALDAAAALSVAE------CVERMAPTLPKSDLNEVKELLKTNKKLAKMIGH 234

  Fly   350 VIAMGEQDPRRMDEIRKYSAIYGRFDCKRRPEKPLTLHEVCVNEAAAQLCRNPQTIWLLTRRDEL 414
            :..|.:.||.:.:|||||||||||||.||:..|.|||||:.|||||||||.....  ||||||||
Human   235 IFEMNDDDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNA--LLTRRDEL 297

  Fly   415 FPLARQIVKDAGFGHS 430
            |.|||||.::..:.::
Human   298 FALARQISREVTYKYT 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nabNP_001014557.3 NCD1 113..190 CDD:282724 55/76 (72%)
NCD2 301..435 CDD:282725 55/134 (41%)
NAB1NP_001308241.1 NCD1 4..82 54/75 (72%)
NCD1 5..83 CDD:398528 55/76 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..188 4/25 (16%)
NCD2 191..317 CDD:398529 54/131 (41%)
NCD2 221..310 49/90 (54%)
Necessary for nuclear localization. /evidence=ECO:0000250 307..338 0/7 (0%)
Nab1 322..486 CDD:398527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160058
Domainoid 1 1.000 126 1.000 Domainoid score I5425
eggNOG 1 0.900 - - E1_KOG3835
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3727
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002244at2759
OrthoFinder 1 1.000 - - FOG0002990
OrthoInspector 1 1.000 - - otm40599
orthoMCL 1 0.900 - - OOG6_108292
Panther 1 1.100 - - O PTHR12623
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3887
SonicParanoid 1 1.000 - - X1985
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.