DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment scaf6 and AT1G18050

DIOPT Version :9

Sequence 1:	NP_001014589.1	Gene:	scaf6 / 3346235	FlyBaseID:	FBgn0261872	Length:	960	Species:	Drosophila melanogaster
Sequence 2:	NP_001319032.1	Gene:	AT1G18050 / 838385	AraportID:	AT1G18050	Length:	224	Species:	Arabidopsis thaliana

Alignment Length:	61	Identity:	20/61 - (32%)
Similarity:	27/61 - (44%)	Gaps:	4/61 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 PPRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGE-FANYYQFRVAAEQA 64
            |||   .|...|..|..|...|||.|.........|||:.|.:..: :..|||.::|..:|
plant   147 PPR---TRYYADSSARLVFMEGPEMERKMMTSYAGNPKYSFFWSSDRYHAYYQKKLAGYRA 204

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
scaf6	NP_001014589.1	Surp	13..61	CDD:280053	14/48 (29%)
		CTD_bind	271..329	CDD:282648
		G-patch	885..933	CDD:279867
AT1G18050	NP_001319032.1	SWAP	155..203	CDD:197818	15/47 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0007
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1256232at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910