DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr3c

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001007203.1 Gene:nitr3c / 796320 ZFINID:ZDB-GENE-041001-13 Length:333 Species:Danio rerio


Alignment Length:310 Identity:61/310 - (19%)
Similarity:107/310 - (34%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SVSWIR----KRDLHI----LTAGILTY----TSDERFKVVRTADSKDWTLHVKYAQPRDSGIYE 189
            ::||.:    |:.|.|    ..:|.:||    .:..||.:  |..|..:.|.:.:.:..|...|.
Zfish    51 TISWYKHSAGKKPLLIAYSDFNSGRVTYRNAFNNTNRFFI--TVASGSYNLTIIHLEKEDFATYY 113

  Fly   190 CQVNTEPKISMAFRLNVIVTPPD---AKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIY 251
            |..:...::.......::....|   :.::|..|....:..|.||||.|.|.....:..  ..:|
Zfish   114 CVKDFLNRLMFGEGTILL
CKETDRISSTSVIQQPVSDRLHPGDSVTLQCSVSSHICAGH--YRVY 176

  Fly   252 W------YRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTA 310
            |      |..|.|:   ..|.|.:...|:. |.:|:..:.....|........|.|.|.|     
Zfish   177 WFKHSSGYSQPGII---YTHDNRSDQCLES-SEKSSFVQSCVYSLSQTELTTSDAGVYYC----- 232

  Fly   311 EAASVVVNVINDESPAAMQKSRAIRTSGSMRS--------------SRLVLLLAMVASSVVRWLI 361
                                  |:.|.|.:|.              |.:||:|.::  |.|..::
Zfish   233 ----------------------AVDTCGKIRFGNGTKLTIEESSLWSPVVLILFVI--SAVSIIV 273

  Fly   362 GGQRIGSNSCHDSCS--------NLSTLHINYCNLR-AKITSHLKEHRCL 402
            ....|....|.:..|        .:.|.:.||..|: :.:|:..:|..|:
Zfish   274 NIFLIIRTYCKEEASEQIRNRVIQVDTNYFNYVALQSSSVTTSQEETICV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 16/80 (20%)
Ig 116..192 CDD:299845 16/66 (24%)
ig 220..306 CDD:278476 22/91 (24%)
IG_like 220..306 CDD:214653 22/91 (24%)
nitr3cNP_001007203.1 V-set 26..130 CDD:284989 16/80 (20%)
IG_like 27..131 CDD:214653 16/81 (20%)
V-set 145..250 CDD:284989 27/137 (20%)
IG_like 154..250 CDD:214653 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.