Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017206634.2 | Gene: | nectin3a / 793240 | ZFINID: | ZDB-GENE-130530-670 | Length: | 550 | Species: | Danio rerio |
Alignment Length: | 394 | Identity: | 70/394 - (17%) |
---|---|---|---|
Similarity: | 121/394 - (30%) | Gaps: | 166/394 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 MPRNITTRTGHTAAINCRVD---NLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDW 173
Fly 174 TLHVKYAQP--------------RDSGIYECQVNT----------------EPKISMAFRLNVIV 208
Fly 209 TPPDAKAIIAGPT--------------DL---------------------YV----KVGSSVTLT 234
Fly 235 CHVKQPATSAQDIGPIYWYRGPYILTPFV-------------------------AHPNDAAIDLQ 274
Fly 275 RISMESTLAEKLQSRLRIANAQLL--------DTGNYTC-------------------------M 306
Fly 307 PTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSR-----------------LVLLLAMVAS 354
Fly 355 SVVR 358 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 24/125 (19%) |
Ig | 116..192 | CDD:299845 | 19/92 (21%) | ||
ig | 220..306 | CDD:278476 | 26/182 (14%) | ||
IG_like | 220..306 | CDD:214653 | 26/182 (14%) | ||
nectin3a | XP_017206634.2 | Ig | 49..146 | CDD:325142 | 18/103 (17%) |
Ig | 149..245 | CDD:325142 | 20/103 (19%) | ||
Ig | 264..325 | CDD:325142 | 10/64 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12424 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |