DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nectin3a

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_017206634.2 Gene:nectin3a / 793240 ZFINID:ZDB-GENE-130530-670 Length:550 Species:Danio rerio


Alignment Length:394 Identity:70/394 - (17%)
Similarity:121/394 - (30%) Gaps:166/394 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MPRNITTRTGHTAAINCRVD---NLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDW 173
            :|..:|:..|....::||::   ||.....||.|.....|:|..:..       .|..|:.:.::
Zfish    39 VPAQVTSVLGKNVTLSCRMEMSSNLSLTQSSWERHLPSGIITLAVFN-------PVYGTSVADEY 96

  Fly   174 TLHVKYAQP--------------RDSGIYECQVNT----------------EPKISMAFRLNVIV 208
            :..|.:.:|              .|.|:|.|::.|                |||:.:: ..::.:
Zfish    97 SRRVHFLKPSVHDVSIVLQGVGFADIGMYTCKMVTFELGNMQASTNVDVMVEPKVYVS-PGSLSL 160

  Fly   209 TPPDAKAIIAGPT--------------DL---------------------YV----KVGSSVTLT 234
            |..|.:.::|..|              ||                     ||    :.....:|:
Zfish   161 TADDGETLVATCTAERGRPAAEVFWESDLPGQTAVVTQSEPEGTTTTLVHYVLAPTRASHGRSLS 225

  Fly   235 CHVKQPATSAQDIGPIYWYRGPYILTPFV-------------------------AHPNDAAIDLQ 274
            |.|:.||.|..       :|.||.|..|.                         |:.|..|:   
Zfish   226 CVVRHPALSRD-------FRIPYRLNVFFVPDVMVIGGKNVWYVGQKDVQLDCKANANPPAL--- 280

  Fly   275 RISMESTLAEKLQSRLRIANAQLL--------DTGNYTC-------------------------M 306
             ..:.:.|...:.:.:.:.|..|:        |:|.|.|                         .
Zfish   281 -FYLWTRLDALMPAGVNMHNGSLVFTRPLEATDSGQYRCEVQNDVGQNFHDVPFLVLDPPPTTAA 344

  Fly   307 PTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSR-----------------LVLLLAMVAS 354
            |||....|..::.....:..|....||..:|.:..|.|                 ||||||:..:
Zfish   345 PTTTTTFSKSLHPDTSLTITAPINQRAHFSSPTRSSPRDADLSTLVGGIVGGILILVLLLALAGA 409

  Fly   355 SVVR 358
            ..:|
Zfish   410 FYMR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 24/125 (19%)
Ig 116..192 CDD:299845 19/92 (21%)
ig 220..306 CDD:278476 26/182 (14%)
IG_like 220..306 CDD:214653 26/182 (14%)
nectin3aXP_017206634.2 Ig 49..146 CDD:325142 18/103 (17%)
Ig 149..245 CDD:325142 20/103 (19%)
Ig 264..325 CDD:325142 10/64 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.