DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nptn

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_012822135.1 Gene:nptn / 733721 XenbaseID:XB-GENE-1011670 Length:407 Species:Xenopus tropicalis


Alignment Length:270 Identity:54/270 - (20%)
Similarity:93/270 - (34%) Gaps:94/270 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PRNITTRTGHTAAINCRVDNLGDKSVSW-----------------IRKRDLHILTA----GILTY 156
            |.:.|..||....:.|.|.......:.|                 .|||.:.|..|    |:.  
 Frog    40 PMSETKLTGDAFELYCEVVGYPTPEIQWWYAEVNRAESFKQLWDGARKRRVTIGAAYGANGVS-- 102

  Fly   157 TSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPK------------ISMAFRLNVIVT 209
                             .|.:......|||.|||:.:.:|:            |.....::|::.
 Frog   103 -----------------VLRITRLTLEDSGTYECRASNDPRRNDLRQNPAMTWIRAQATVSVLLK 150

  Fly   210 PPDAKAIIAGPTDLYVKVGSSVT---LTCHVKQPATSAQ-DIGPIYWYRGPYILTPFVAHPNDAA 270
            |.     |:...::.:|..::.|   |.|::  ..||:| ::..:||.:            |...
 Frog   151 PK-----ISATEEITIKKDTTPTPIFLQCNL--TVTSSQGELESVYWTK------------NGLE 196

  Fly   271 I-DLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPA-AMQKSRA 333
            : |.::.|.|..:      .|:||..:..|:|.|.|          |....|:..|| |..:.:|
 Frog   197 VQDTRKNSPEFVM------ELKIAKPKADDSGEYMC----------VFTFKNNSPPANATIEVKA 245

  Fly   334 I-RTSGSMRS 342
            : ..||..:|
 Frog   246 VPEISGHKKS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 22/125 (18%)
Ig 116..192 CDD:299845 19/96 (20%)
ig 220..306 CDD:278476 19/90 (21%)
IG_like 220..306 CDD:214653 19/90 (21%)
nptnXP_012822135.1 Ig 51..124 CDD:319273 16/91 (18%)
Ig <190..238 CDD:386229 15/75 (20%)
Ig 259..342 CDD:386229
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.