DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Sirpb1b

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006530146.1 Gene:Sirpb1b / 668101 MGIID:3779828 Length:408 Species:Mus musculus


Alignment Length:148 Identity:37/148 - (25%)
Similarity:57/148 - (38%) Gaps:35/148 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 IIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRG----PYILTPFVAHPNDAAIDLQRI 276
            :|......:|..|.|.||.|.|    ||...:|||.||||    ..::..|...      ...||
Mouse    33 VIQPVKSFFVGAGGSATLNCTV----TSLLPVGPIRWYRGVGQSRLLIQSFTGE------HFPRI 87

  Fly   277 SMESTLAEK--LQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGS 339
            :..|.:.::  |...:||:|....|:|.|.|:..               ...:.:..|.|::.|.
Mouse    88 TSVSDVTKRNNLDFSIRISNVTPADSGTYYCVKF---------------QRGSSESDREIQSGGG 137

  Fly   340 MRSSRLVLLLAMVASSVV 357
            ...|    :||..:|.:|
Mouse   138 TELS----VLAKPSSPMV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653
Ig 116..192 CDD:299845
ig 220..306 CDD:278476 27/91 (30%)
IG_like 220..306 CDD:214653 27/91 (30%)
Sirpb1bXP_006530146.1 Ig 32..143 CDD:386229 33/138 (24%)
IgC_SIRP_domain_2 145..248 CDD:319314 2/7 (29%)
IgC_SIRP_domain_3 250..352 CDD:319334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12440
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.