DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Btnl6

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_109672.1 Gene:Btnl6 / 624681 MGIID:1932038 Length:539 Species:Mus musculus


Alignment Length:324 Identity:70/324 - (21%)
Similarity:104/324 - (32%) Gaps:84/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FGMPRNITTRTGHTAAINC------RVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTA 168
            ||....|....|..|.:.|      .|:|:  :.:.|.|.|    .:|.:|.|...|..|..:..
Mouse    34 FGPSDPIVAAPGGEAILPCSVIPAMNVENM--EELRWFRSR----FSAAVLVYRDQEEQKREQLP 92

  Fly   169 DSKDWTLHVK-------------YAQPRDSGIYECQ----VNTEPKISMAFRLNVIVTPPDAKAI 216
            :....|..||             ..|..|||||.|.    |..|..|   ..|.|.......:..
Mouse    93 EYSQRTSLVKEQFHQGTAAVRILNVQAPDSGIYICHFKQGVFYEEAI---LELKVAAMGSVPEVY 154

  Fly   217 IAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMEST 281
            |.||.|      ..|.:.|     .||.       ||..|.:      |..|:..:....|:| .
Mouse   155 IKGPED------GGVCVVC-----ITSG-------WYPEPQV------HWKDSRGEKLTASLE-I 194

  Fly   282 LAEKLQSRLRIANAQLL---DTGNYTCM---PTTAEAASVVVNV-------INDESPA-----AM 328
            .:|..|...|...:.::   ...|.||.   |...:..::.:.:       ::...||     .|
Mouse   195 HSEDAQGLFRTETSLVVRDSSVRNVTCSTFNPILGQEKAMAMFLPEPFFPKVSPWKPAFFVTLTM 259

  Fly   329 QKSRAIRTSGSMRSSRLVLLLAMVASSVVRWLIGG-QRIGSNSC-HDSCSNLSTLHINYCNLRA 390
            .....:.||...|..|...|       :|:.|.|. ||:..|.. .|:...:..|.:.....:|
Mouse   260 MGLLVLGTSYLFRRERSARL-------IVQELTGNLQRVEDNKAEEDTVRTIDALMVELAQRKA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/115 (24%)
Ig 116..192 CDD:299845 24/98 (24%)
ig 220..306 CDD:278476 18/88 (20%)
IG_like 220..306 CDD:214653 18/88 (20%)
Btnl6NP_109672.1 Ig 45..145 CDD:386229 27/108 (25%)
Ig 150..232 CDD:386229 22/106 (21%)
SPRY_PRY_C-I_1 341..503 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.