DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr4a

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571729.1 Gene:nitr4a / 60652 ZFINID:ZDB-GENE-001106-11 Length:337 Species:Danio rerio


Alignment Length:224 Identity:55/224 - (24%)
Similarity:88/224 - (39%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITTRTGHTAAINCRV--DN----------LGDKSVSWIRKRDLHILTAGI-----LTYTSD---- 159
            :||:.||...:.|.:  ||          ||:|.|         ::.:..     ..::||    
Zfish    31 LTTQEGHIVLLPCLLLEDNFHRVIWYKQVLGEKPV---------VIVSSYHHSQPNEFSSDFKET 86

  Fly   160 ERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAK-AIIAGPTDL 223
            :||..||.|||  :.|.::.....|||.|.|.......:|......::|...|.| |:|..|...
Zfish    87 QRFHAVRKADS--FNLTIRRTLKSDSGTYFCGSAFTHVVSFGTGTILLVK
GADLKPAVIQLPVHA 149

  Fly   224 YVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTP---FVAH---PNDAAIDLQRISMESTL 282
            .:|.||:|||.|.| :..|..:.:..:||:|.....|.   ...|   .|:.|        :|:.
Zfish   150 VIKPGSNVTLRCSV-EGKTCDKGVQSVYWFRQSSSTTHQGIVYTHGKSKNECA--------DSSD 205

  Fly   283 AEKLQSRLRIANAQLLDTGNYTCMPTTAE 311
            .:.....|...:..:.:.|.|.|...|.:
Zfish   206 TQSCLQNLAKMSVNVSEAGLYYCSVVTCD 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 27/110 (25%)
Ig 116..192 CDD:299845 26/96 (27%)
ig 220..306 CDD:278476 21/91 (23%)
IG_like 220..306 CDD:214653 21/91 (23%)
nitr4aNP_571729.1 Ig 24..134 CDD:299845 27/113 (24%)
IG_like 29..127 CDD:214653 27/106 (25%)
V-set 144..246 CDD:284989 23/100 (23%)
IG_like 146..246 CDD:214653 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.