DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr3a

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571727.1 Gene:nitr3a / 60649 ZFINID:ZDB-GENE-001106-8 Length:337 Species:Danio rerio


Alignment Length:252 Identity:51/252 - (20%)
Similarity:90/252 - (35%) Gaps:55/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SVSWIR----KRDLHILTAGI----LTY----TSDERFKVVRTADSKDWTLHVKYAQPRDSGIYE 189
            :|||.:    |:.|.|..:..    :||    .:..||.:  |..|..:.|.:.:.:..|...|.
Zfish    51 TVSWTKHSSGKKPLLIAYSDFNSERVTYQNAFNNTNRFFI--TIASGCYNLTILHLEKEDFANYY 113

  Fly   190 CQVNTEPKISMAFRLNVIVTPPD---AKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIY 251
            |..:...::.......::....|   :.::|..|....:..|.||||.|.|.....:..  ..:|
Zfish   114 CVKDFLNRLMFGEGTILLR
KETDRISSTSVIQQPVSDRLHPGDSVTLQCSVSSHICAGH--YRVY 176

  Fly   252 WYR-GPYILTPFVAHPNDAAID-LQRISMESTLAEKLQSRLRIANAQLLDTGNYTC--------- 305
            |:: ......|.:.:.:|...| ..:.|.:|:..:.....|........|.|.|.|         
Zfish   177 WFKHSSGYSQPGIIYTHDNRSDQCLKSSEKSSFVQSCVYSLSQTELTTSDAGVYYCAVDTCGKIH 241

  Fly   306 ----MPTTAEAA----------------SVVVNVINDESPAAMQKSRAIRTSGSMRS 342
                ...|.||:                |:|||::     ..:||:|...|:..:||
Zfish   242 FGNGTKLTIEASFFWNPVAVILFTISVTSIVVNIV-----LVIQKNRRKETTEHLRS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 16/80 (20%)
Ig 116..192 CDD:299845 16/66 (24%)
ig 220..306 CDD:278476 20/100 (20%)
IG_like 220..306 CDD:214653 20/100 (20%)
nitr3aNP_571727.1 V-set 26..130 CDD:284989 16/80 (20%)
IG_like 27..132 CDD:214653 16/82 (20%)
V-set 145..250 CDD:284989 20/106 (19%)
IG_like 154..250 CDD:214653 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.