DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr2b

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571724.1 Gene:nitr2b / 60647 ZFINID:ZDB-GENE-001106-6 Length:313 Species:Danio rerio


Alignment Length:204 Identity:44/204 - (21%)
Similarity:70/204 - (34%) Gaps:47/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LYVKVGSSVTLTC-HVKQPATSAQDIGPIYWYRGPYILTPFV----------AHPNDAAIDLQ-R 275
            :.|:.|.:|.||| ..|:..||      :.|.:......|.:          .:.||  .|.| |
Zfish    29 MIVQAGVAVNLTCIFPKESRTS------VVWVKQRVGEKPLLIASAYQGLAGKYEND--FDKQNR 85

  Fly   276 ISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAE-----AASVVV-----NVINDESPAAMQK 330
            ..:|.   ::....|.|||.::.||..|.|:....|     :..::|     |:.::...:|.:.
Zfish    86 FFIEK---DEGSFNLSIANTEISDTATYYCVAYVYEFIFGNSTDLIVNAGKLNIKSEHQRSASED 147

  Fly   331 SRAIRTSGSMRSSRLVLLLAMVASSVVRWLIGGQRIGSNSCHDSCSNLSTLH------------- 382
            .:....|.|......|......:......:|..|...|..|..|....||.|             
Zfish   148 QQCSVISQSCAEEHKVYWFRQGSGESSPGVIYTQNSRSAQCEKSSDLNSTAHKCIYSLPKTDEDP 212

  Fly   383 -INYCNLRA 390
             |.||.:.|
Zfish   213 AIYYCAVAA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653
Ig 116..192 CDD:299845
ig 220..306 CDD:278476 24/94 (26%)
IG_like 220..306 CDD:214653 24/94 (26%)
nitr2bNP_571724.1 IG_like 28..129 CDD:214653 26/110 (24%)
IgV 29..129 CDD:143167 26/110 (24%)
Ig 149..232 CDD:299845 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.