DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr1k

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_938162.3 Gene:nitr1k / 60646 ZFINID:ZDB-GENE-001106-5 Length:328 Species:Danio rerio


Alignment Length:328 Identity:59/328 - (17%)
Similarity:114/328 - (34%) Gaps:53/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FDFGMPRNI-TTRTGHTAAINCRVDNLGDKSVSWIRK----RDLHILTAGI-------LTYTSDE 160
            ||.....|: ....|......|:...|.....:|.::    :.|.|:::.:       ..:....
Zfish    19 FDVVQEDNVKIVEAGKDVNFTCKFPELVQSINTWFKQTTDGKSLQIVSSYLNQQPSWNHNFVKTN 83

  Fly   161 RFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIV--TPPDAKAIIAGPTDL 223
            ||.|..  ::..:.|.:...:..||..|.|.::....|.|.....::|  :..|..:.:......
Zfish    84 RFNVAN--ENGYFNLTIFKTKSSDSATYYCVISAYQTIGMGSGTRLLVGDSATDRNSTLHQSLID 146

  Fly   224 YVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQS 288
            .|..|.:|.|.|.:...:.:...  .|||::.....:..|.:.........:.|.||.....:.|
Zfish   147 AVDPGDAVNLQCSIFTESCAGDH--SIYWFKQSSGDSEGVLYTKGERNGRCKNSTESQTQSCVYS 209

  Fly   289 RLRIANAQLLDTGNYTCMPTTAEAASVV------VNVIN--DESPAAMQKSRAIRTSGSMRSSRL 345
             |...|....|:|.|.|  ..|....::      :|:..  |.:||.:       .||.:.    
Zfish   210 -LHKNNISRSDSGIYYC--AVAACGQILLGRGTQLNIRESCDFNPALL-------ASGILN---- 260

  Fly   346 VLLLAMV-------ASSVVRWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAKIT------SHLK 397
            ::.||:|       ..|.::..........:|.:.:..|.....:|....||.:|      :|::
Zfish   261 IIFLALVVFLGIKLCRSQIKTSAAQTTQNEDSLNYASINFRQKPLNTRKARANVTQDQSLYAHVR 325

  Fly   398 EHR 400
            .|:
Zfish   326 SHQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 17/104 (16%)
Ig 116..192 CDD:299845 14/87 (16%)
ig 220..306 CDD:278476 18/85 (21%)
IG_like 220..306 CDD:214653 18/85 (21%)
nitr1kNP_938162.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.