DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr1i

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571721.1 Gene:nitr1i / 60644 ZFINID:ZDB-GENE-001106-3 Length:335 Species:Danio rerio


Alignment Length:102 Identity:26/102 - (25%)
Similarity:42/102 - (41%) Gaps:19/102 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VFDFGMPRNITTR--------TGHTAAINCRV---DNLGDKSVSWIRKRDLHILTAGILTYTSDE 160
            |.|....||.|..        .|.:..:.|.:   ...||.|:.|.::  :...:.|:: ||..|
Zfish   144 VRDADADRNTTLHQSLIDAVDPGDSVNLQCSIFTESCAGDHSIYWFKQ--ISGDSVGLI-YTKGE 205

  Fly   161 R-FKVVRTADSKD----WTLHVKYAQPRDSGIYECQV 192
            | .:...:.:|:.    ::||.......|||||.|.|
Zfish   206 RNGRCKNSTESQTQSCVYSLHKNNISRSDSGIYYCAV 242

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 24/96 (25%)
Ig 116..192 CDD:299845 21/91 (23%)
ig 220..306 CDD:278476
IG_like 220..306 CDD:214653