DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and cadm2b

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_005157530.1 Gene:cadm2b / 571698 ZFINID:ZDB-GENE-080506-3 Length:441 Species:Danio rerio


Alignment Length:202 Identity:56/202 - (27%)
Similarity:85/202 - (42%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWT 174
            |.:.:|:|...|.||.:.||||...:.|:.|..... ..|..|......|.|.::|| |..|:.|
Zfish    35 FPITQNVTVVEGSTANMTCRVDYNDNTSLQWSNPAQ-QTLFFGDKKALRDNRIELVR-ASWKELT 97

  Fly   175 LHVKYAQPRDSGIYECQVNTEP-KISMAFRLNVIVTPPDAKAIIAG---PTDLYVKVGSSVTLTC 235
            :.:......|.|.|.|.:.|.| |.|.|| |.|:..|  ||..|.|   |    .:.|..|||||
Zfish    98 ISISDVALSDEGQYTCSLFTMPVKTSKAF-LTVLGVP--AKPEITGLSRP----AQEGEDVTLTC 155

  Fly   236 HVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMEST-LAEKLQSRLRIANAQLLD 299
                ..:.::....|.|:|            ||..:...:..:.:| .:..::|.:.:...:..|
Zfish   156 ----TTSGSKPAADIRWFR------------NDKEVQAGQKEVNATGRSFTVRSSVHLKVDRKDD 204

  Fly   300 TGNYTCM 306
            ...|||:
Zfish   205 GAAYTCV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 31/93 (33%)
Ig 116..192 CDD:299845 23/75 (31%)
ig 220..306 CDD:278476 17/86 (20%)
IG_like 220..306 CDD:214653 17/86 (20%)
cadm2bXP_005157530.1 Ig 35..129 CDD:299845 32/96 (33%)
IG_like 39..129 CDD:214653 31/92 (34%)
Ig 151..230 CDD:299845 16/77 (21%)
I-set 234..320 CDD:254352
IGc2 247..310 CDD:197706
4.1m 363..381 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.