Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157530.1 | Gene: | cadm2b / 571698 | ZFINID: | ZDB-GENE-080506-3 | Length: | 441 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 56/202 - (27%) |
---|---|---|---|
Similarity: | 85/202 - (42%) | Gaps: | 30/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 FGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWT 174
Fly 175 LHVKYAQPRDSGIYECQVNTEP-KISMAFRLNVIVTPPDAKAIIAG---PTDLYVKVGSSVTLTC 235
Fly 236 HVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMEST-LAEKLQSRLRIANAQLLD 299
Fly 300 TGNYTCM 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 31/93 (33%) |
Ig | 116..192 | CDD:299845 | 23/75 (31%) | ||
ig | 220..306 | CDD:278476 | 17/86 (20%) | ||
IG_like | 220..306 | CDD:214653 | 17/86 (20%) | ||
cadm2b | XP_005157530.1 | Ig | 35..129 | CDD:299845 | 32/96 (33%) |
IG_like | 39..129 | CDD:214653 | 31/92 (34%) | ||
Ig | 151..230 | CDD:299845 | 16/77 (21%) | ||
I-set | 234..320 | CDD:254352 | |||
IGc2 | 247..310 | CDD:197706 | |||
4.1m | 363..381 | CDD:128590 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |