DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and cntn4

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001073520.1 Gene:cntn4 / 571349 ZFINID:ZDB-GENE-060929-776 Length:1028 Species:Danio rerio


Alignment Length:208 Identity:51/208 - (24%)
Similarity:83/208 - (39%) Gaps:44/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHV 177
            |:::......:....|:.......|..|::.        |.....::||.:|:..|      |.:
Zfish   325 PQDVQKPIDDSLVWECKATGKPKPSYRWMKN--------GENLEPTEERVQVINGA------LSI 375

  Fly   178 KYAQPRDSGIYECQV-NTEPKISMAFRLNVIVTPPD-AKAIIAGPTDLYVKVGSSVTLTCHVKQP 240
            .:....|.|:|:|.. |...::.....|.||...|| ::..:...|  .||.|..|.:.|   :|
Zfish   376 THLALSDIGMYQCVAGNKYGEVYSNAELRVIAVAPDFSQNQLKSHT--LVKEGGDVLIEC---KP 435

  Fly   241 ATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRIS-MESTLAEKLQSRLRIANAQLLDTGNYT 304
            ..|.:  |.|.|.:|           |||..:..||: :||       ..|||:|....|.|:||
Zfish   436 KMSPR--GSISWRKG-----------NDALRESSRIAVLES-------GSLRISNVSKSDAGSYT 480

  Fly   305 CMPTT--AEAASV 315
            |:...  .||:|:
Zfish   481 CVARNQFGEASSL 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 16/93 (17%)
Ig 116..192 CDD:299845 13/75 (17%)
ig 220..306 CDD:278476 27/86 (31%)
IG_like 220..306 CDD:214653 27/86 (31%)
cntn4NP_001073520.1 I-set 26..118 CDD:254352
Ig 26..116 CDD:299845
Ig 121..216 CDD:299845
IG_like 131..207 CDD:214653
Ig 228..316 CDD:299845
I-set 228..309 CDD:254352
I-set 319..405 CDD:254352 16/93 (17%)
Ig 320..405 CDD:299845 16/93 (17%)
I-set 410..498 CDD:254352 33/109 (30%)
Ig 426..498 CDD:299845 28/91 (31%)
I-set 504..597 CDD:254352
Ig 517..601 CDD:299845
FN3 601..693 CDD:238020
FN3 707..799 CDD:238020
FN3 808..901 CDD:238020
FN3 893..994 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.