Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073520.1 | Gene: | cntn4 / 571349 | ZFINID: | ZDB-GENE-060929-776 | Length: | 1028 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 51/208 - (24%) |
---|---|---|---|
Similarity: | 83/208 - (39%) | Gaps: | 44/208 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 PRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHV 177
Fly 178 KYAQPRDSGIYECQV-NTEPKISMAFRLNVIVTPPD-AKAIIAGPTDLYVKVGSSVTLTCHVKQP 240
Fly 241 ATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRIS-MESTLAEKLQSRLRIANAQLLDTGNYT 304
Fly 305 CMPTT--AEAASV 315 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 16/93 (17%) |
Ig | 116..192 | CDD:299845 | 13/75 (17%) | ||
ig | 220..306 | CDD:278476 | 27/86 (31%) | ||
IG_like | 220..306 | CDD:214653 | 27/86 (31%) | ||
cntn4 | NP_001073520.1 | I-set | 26..118 | CDD:254352 | |
Ig | 26..116 | CDD:299845 | |||
Ig | 121..216 | CDD:299845 | |||
IG_like | 131..207 | CDD:214653 | |||
Ig | 228..316 | CDD:299845 | |||
I-set | 228..309 | CDD:254352 | |||
I-set | 319..405 | CDD:254352 | 16/93 (17%) | ||
Ig | 320..405 | CDD:299845 | 16/93 (17%) | ||
I-set | 410..498 | CDD:254352 | 33/109 (30%) | ||
Ig | 426..498 | CDD:299845 | 28/91 (31%) | ||
I-set | 504..597 | CDD:254352 | |||
Ig | 517..601 | CDD:299845 | |||
FN3 | 601..693 | CDD:238020 | |||
FN3 | 707..799 | CDD:238020 | |||
FN3 | 808..901 | CDD:238020 | |||
FN3 | 893..994 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |