DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dscama

DIOPT Version :10

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_068079922.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2037 Species:Danio rerio


Alignment Length:384 Identity:78/384 - (20%)
Similarity:144/384 - (37%) Gaps:72/384 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AVKSLSHLVDGNDNLLPMVSAPSSI--DNDYVYIASVNRKFPQFG-------NSIDDEREAEEQ- 96
            :|::...:|....:.:|:||....:  ....:||..|.::...|.       ....:.|::... 
Zfish   162 SVENYITVVSWERDTVPLVSGARFLITSTGALYILDVQKEDELFNYRCMTRHRYTSETRQSNSAR 226

  Fly    97 ---PPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIR-KRDLHILTAGILTYT 157
               |.:.:...|.:.|....|.:  ...|...:.|:..........|:: .|.|.          
Zfish   227 LFVPADPSNSAPAILDGFEKREV--MASHRVELPCKASGHPAPKYRWLKNNRPLE---------- 279

  Fly   158 SDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQV-NTEPKISMAFRLNVIVTPPDAKAIIAGPT 221
            ||.||:...|.      |.::.|||.|:|.|.|:| |:.....:..||.|   ....||::: |.
Zfish   280 SDSRFRQSVTG------LLIERAQPSDTGSYVCEVWNSYGNAEVIGRLTV---KEPLKAVVS-PR 334

  Fly   222 DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYR-GPYILTPFVAHPNDAAIDLQRISMESTLAEK 285
            .:...|||.|:|:|.|     :..|...:.||| |..|.|       .|.|.:..|:.|:.:.:.
Zfish   335 KVKGSVGSQVSLSCSV-----TGSDEFELSWYRNGDKINT-------GANIRMNGINKENLVMDG 387

  Fly   286 LQSRLRIANAQLLDTGNYTCMPTTAE-AASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLL 349
            :...         |.|.|.|....|: :|...|.||.::....:..:.:.:..|......|...:
Zfish   388 MAKS---------DGGVYQCFSRKAKMSAQDFVQVILEDGTPKILSAFSEKVVGPNDFVSLTCHV 443

  Fly   350 AMVASSVVRWLIGGQRIGSNSCHDSCSNLSTLH--INYCNLRAKITSHLK-----EHRC 401
            .......:.|.:..:.:..:|.|....:::...  ::|.|:     ||::     .:||
Zfish   444 KGTPQPAITWTLDDEVVAKDSRHRIVHSITAEGNVVSYLNI-----SHIQVRDSGVYRC 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 23/94 (24%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 0/5 (0%)
FR2 137..151 CDD:409355 3/14 (21%)
Ig strand C 137..143 CDD:409355 1/6 (17%)
Ig strand C' 149..153 CDD:409355 0/3 (0%)
CDR2 153..162 CDD:409355 2/8 (25%)
Ig strand D 162..167 CDD:409355 1/4 (25%)
FR3 163..192 CDD:409355 9/28 (32%)
Ig strand E 172..178 CDD:409355 1/5 (20%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 22/86 (26%)
Ig strand B 231..235 CDD:409353 2/3 (67%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 0/2 (0%)
Ig strand F 302..307 CDD:409353 2/4 (50%)
Ig strand G 310..313 CDD:409353 1/3 (33%)
dscamaXP_068079922.1 Ig 38..133 CDD:472250
Ig strand B 54..58 CDD:409353
Ig strand C 67..71 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 111..116 CDD:409353
Ig strand G 124..128 CDD:409353
Ig 137..212 CDD:472250 9/49 (18%)
Ig strand B 153..157 CDD:409353
Ig strand C 169..173 CDD:409353 1/3 (33%)
Ig strand E 191..195 CDD:409353 0/3 (0%)
Ig strand F 205..211 CDD:409353 1/5 (20%)
I-set 248..323 CDD:400151 22/92 (24%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 290..293 CDD:409353 1/8 (13%)
Ig strand F 303..308 CDD:409353 2/4 (50%)
Ig 326..408 CDD:472250 26/103 (25%)
Ig strand B 344..348 CDD:409353 2/3 (67%)
Ig strand C 357..361 CDD:409353 0/3 (0%)
Ig strand E 381..385 CDD:409353 1/3 (33%)
Ig strand F 395..400 CDD:409353 2/4 (50%)
Ig 419..514 CDD:472250 11/84 (13%)
Ig strand B 437..441 CDD:409353 1/3 (33%)
Ig strand C 450..454 CDD:409353 0/3 (0%)
Ig strand E 480..484 CDD:409353 1/3 (33%)
Ig strand F 494..499 CDD:409353 2/4 (50%)
Ig strand G 507..510 CDD:409353
IgI_5_Dscam 520..606 CDD:409550
Ig strand A' 525..529 CDD:409550
Ig strand B 532..539 CDD:409550
Ig strand C 546..552 CDD:409550
Ig strand C' 553..555 CDD:409550
Ig strand D 562..566 CDD:409550
Ig strand E 570..576 CDD:409550
Ig strand F 584..592 CDD:409550
Ig strand G 596..606 CDD:409550
Ig 609..699 CDD:472250
Ig strand B 626..630 CDD:409353
Ig strand C 640..644 CDD:409353
Ig strand E 665..669 CDD:409353
Ig strand F 679..684 CDD:409353
Ig strand G 692..695 CDD:409353
Ig_DSCAM 702..799 CDD:409397
putative Ig strand A 702..706 CDD:409397
putative Ig strand A' 711..715 CDD:409397
putative Ig strand B 717..727 CDD:409397
putative Ig strand C 733..739 CDD:409397
putative Ig strand C' 746..749 CDD:409397
putative Ig strand D 759..762 CDD:409397
putative Ig strand E 764..770 CDD:409397
putative Ig strand F 777..785 CDD:409397
putative Ig strand G 790..799 CDD:409397
Ig_DSCAM 800..905 CDD:409398
putative Ig strand A 800..803 CDD:409398
putative Ig strand A' 811..815 CDD:409398
putative Ig strand B 818..825 CDD:409398
putative Ig strand C 833..839 CDD:409398
putative Ig strand C' 854..857 CDD:409398
putative Ig strand D 863..867 CDD:409398
putative Ig strand E 869..875 CDD:409398
putative Ig strand F 882..890 CDD:409398
putative Ig strand G 893..903 CDD:409398
FN3 906..1000 CDD:238020
FN3 <956..>1251 CDD:442628
fn3 1211..1294 CDD:394996
Ig 1324..1387 CDD:409353
Ig strand B 1324..1328 CDD:409353
Ig strand C 1337..1341 CDD:409353
Ig strand E 1362..1366 CDD:409353
Ig strand F 1376..1381 CDD:409353
fn3 1417..1483 CDD:394996
FN3 1504..1575 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.