DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and cadm1b

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001107024.1 Gene:cadm1b / 562183 ZFINID:ZDB-GENE-080327-34 Length:411 Species:Danio rerio


Alignment Length:191 Identity:45/191 - (23%)
Similarity:75/191 - (39%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NITTRTGHTAAINCRVDNLGDKSVSWIRK-------RDLHILTAGILTYTSDERFKVVRTADSKD 172
            |::...|.||.|:|||.|..|..:..:..       ||:..|        .|.||::|..:|: :
Zfish    51 NVSVVEGETAIISCRVKNNDDSVIQLLNPNRQTIYFRDVRPL--------KDSRFQLVNFSDN-E 106

  Fly   173 WTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHV 237
            ..:.:......|.|.|.||:.|:|.......:.|:|  |....|:....:: |..|:...:||  
Zfish   107 LLVSLSNVSLSDEGRYVCQLYTDPPQEAYADITV
LV--PPGNPILESREEI-VSEGNETEITC-- 166

  Fly   238 KQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAE------KLQSRLRI 292
              .|..::....|.|.:|.                 |.:..|:|:.|      .:.||||:
Zfish   167 --TAMGSKPASTIKWMKGD-----------------QPLQGEATVEELYDRMFTVTSRLRL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/97 (26%)
Ig 116..192 CDD:299845 21/82 (26%)
ig 220..306 CDD:278476 16/79 (20%)
IG_like 220..306 CDD:214653 16/79 (20%)
cadm1bNP_001107024.1 Ig1_Necl-2 46..140 CDD:143289 25/97 (26%)
IG_like 51..140 CDD:214653 25/97 (26%)
Ig 161..242 CDD:299845 14/69 (20%)
Ig_3 242..316 CDD:290638
IG_like 252..329 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.