DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and ptk7a

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001018501.1 Gene:ptk7a / 553690 ZFINID:ZDB-GENE-050522-216 Length:231 Species:Danio rerio


Alignment Length:196 Identity:38/196 - (19%)
Similarity:75/196 - (38%) Gaps:48/196 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ISRAWTMQQQHLSPAIQQHPAVKSLSHLVDGNDNLLPMVSAPSSIDN-DYVYIASVNRKFPQFGN 85
            :|.||....:         |...|....:||.:  |...:...::|: ::..|||.|        
Zfish    65 VSYAWIQNGE---------PVTNSERRFLDGGN--LKFTAIDRTLDSGNFQCIASKN-------- 110

  Fly    86 SIDDEREAEEQPPEETTYPPPVFDFG-----MPRNIT-TRTGHTAAINCRVDNLGDKSVSWIRKR 144
                 ...||:...||::.....:.|     .|.::. .::.....:.|.:|.....:..|.:..
Zfish   111 -----STGEEERTAETSFNIKWLESGAVSLKSPESVAEIQSSSQVILRCNIDGHPRPTNRWFKDG 170

  Fly   145 DLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYE-CQVNTEPKI--SMAFRLNV 206
                      |..:::.:|:    ::|:.:|.:..|.|.|:|:|. |..|...::  |..|.||:
Zfish   171 ----------TQITEKNYKI----NNKERSLTLPNASPDDNGLYFCCAKNAAGQVCSSDNFTLNI 221

  Fly   207 I 207
            |
Zfish   222 I 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 18/96 (19%)
Ig 116..192 CDD:299845 13/77 (17%)
ig 220..306 CDD:278476
IG_like 220..306 CDD:214653
ptk7aNP_001018501.1 I-set 37..120 CDD:254352 15/78 (19%)
Ig 42..122 CDD:299845 16/80 (20%)
Ig 150..222 CDD:299845 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.