Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018501.1 | Gene: | ptk7a / 553690 | ZFINID: | ZDB-GENE-050522-216 | Length: | 231 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 38/196 - (19%) |
---|---|---|---|
Similarity: | 75/196 - (38%) | Gaps: | 48/196 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 ISRAWTMQQQHLSPAIQQHPAVKSLSHLVDGNDNLLPMVSAPSSIDN-DYVYIASVNRKFPQFGN 85
Fly 86 SIDDEREAEEQPPEETTYPPPVFDFG-----MPRNIT-TRTGHTAAINCRVDNLGDKSVSWIRKR 144
Fly 145 DLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYE-CQVNTEPKI--SMAFRLNV 206
Fly 207 I 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 18/96 (19%) |
Ig | 116..192 | CDD:299845 | 13/77 (17%) | ||
ig | 220..306 | CDD:278476 | |||
IG_like | 220..306 | CDD:214653 | |||
ptk7a | NP_001018501.1 | I-set | 37..120 | CDD:254352 | 15/78 (19%) |
Ig | 42..122 | CDD:299845 | 16/80 (20%) | ||
Ig | 150..222 | CDD:299845 | 18/85 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |