DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:285 Identity:67/285 - (23%)
Similarity:107/285 - (37%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSD-------------ERFKV 164
            |.:.|...|..|.:.|.:.|.                 :||:.:|.|             .|::|
Human    27 PADQTVVAGQRAVLPCVLLNY-----------------SGIVQWTKDGLALGMGQGLKAWPRYRV 74

  Fly   165 VRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGS 229
            |.:||:..:.|.:..|:..|...||||.......|...:|.|::.|.|.: |..||. :.::.|:
Human    75 VGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTR-IDGGPV-ILLQAGT 137

  Fly   230 SVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIAN 294
            ...|||.    |.:|:....|.|:|........|     |:.:|.:.....|...:|     :.|
Human   138 PHNLTCR----AFNAKPAATIIWFRDGTQQEGAV-----ASTELLKDGKRETTVSQL-----LIN 188

  Fly   295 AQLLDTGN-YTC------MPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMV 352
            ...||.|. :||      :|:..| .|:.::|   ..|..:..|  |.........|:|......
Human   189 PTDLDIGRVFTCRSMNEAIPSGKE-TSIELDV---HHPPTVTLS--IEPQTVQEGERVVFTCQAT 247

  Fly   353 ASSVV---RWLIGGQRIGSNSCHDS 374
            |:..:   ||..||..|  ...|:|
Human   248 ANPEILGYRWAKGGFLI--EDAHES 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 24/105 (23%)
Ig 116..192 CDD:299845 20/88 (23%)
ig 220..306 CDD:278476 21/92 (23%)
IG_like 220..306 CDD:214653 21/92 (23%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 24/105 (23%)
Ig 25..116 CDD:299845 24/105 (23%)
Ig2_KIRREL3-like 138..219 CDD:143236 22/95 (23%)
I-set 223..304 CDD:254352 12/52 (23%)
Ig_2 227..305 CDD:290606 12/48 (25%)
Ig_2 311..405 CDD:290606
IG_like 314..405 CDD:214653
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.