DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and iglon5

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:291 Identity:54/291 - (18%)
Similarity:93/291 - (31%) Gaps:111/291 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DFG-MPRNITTRTGHTAAINCRVD-NLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSK 171
            :|| :|.|||...|.:..:.|::| .:..|  :|:.:.  :||..|...::.|.|..:....:| 
Zfish    28 EFGHLPDNITVLEGESVVLRCKIDEEVTHK--AWLNRS--NILFTGTDKWSLDSRVSLENNNNS- 87

  Fly   172 DWTLHVKYAQPRDSGIYEC--QVNTEPKISMAFRL------------------------------ 204
            |:::.::.....|.|.|.|  |...:|:.:..:.:                              
Zfish    88 DFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVG 152

  Fly   205 ---------------------------------------NVIVTPPDAK---------AIIAGPT 221
                                                   |..|.|||.:         .||....
Zfish   153 RPEPTITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVK 217

  Fly   222 DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLA--- 283
            ::..:||.:..|.|......|::.:     |||.                |.:.:..::||.   
Zfish   218 NMPAQVGKTAILRCEAMAVPTASFE-----WYRD----------------DRRPVESDNTLKIKN 261

  Fly   284 EKLQSRLRIANAQLLDTGNYTCMPTTAEAAS 314
            ||.:|.|...|......|||||..:....||
Zfish   262 EKTRSLLLFTNVTEKHFGNYTCFASNRLGAS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 22/164 (13%)
Ig 116..192 CDD:299845 18/78 (23%)
ig 220..306 CDD:278476 20/88 (23%)
IG_like 220..306 CDD:214653 20/88 (23%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 22/94 (23%)
Ig 35..123 CDD:299845 21/92 (23%)
Ig 125..>183 CDD:299845 0/57 (0%)
I-set 128..207 CDD:254352 5/78 (6%)
IG_like 217..298 CDD:214653 23/97 (24%)
ig 223..296 CDD:278476 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.