Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017775.2 | Gene: | iglon5 / 550472 | ZFINID: | ZDB-GENE-050417-297 | Length: | 332 | Species: | Danio rerio |
Alignment Length: | 291 | Identity: | 54/291 - (18%) |
---|---|---|---|
Similarity: | 93/291 - (31%) | Gaps: | 111/291 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 DFG-MPRNITTRTGHTAAINCRVD-NLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSK 171
Fly 172 DWTLHVKYAQPRDSGIYEC--QVNTEPKISMAFRL------------------------------ 204
Fly 205 ---------------------------------------NVIVTPPDAK---------AIIAGPT 221
Fly 222 DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLA--- 283
Fly 284 EKLQSRLRIANAQLLDTGNYTCMPTTAEAAS 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 22/164 (13%) |
Ig | 116..192 | CDD:299845 | 18/78 (23%) | ||
ig | 220..306 | CDD:278476 | 20/88 (23%) | ||
IG_like | 220..306 | CDD:214653 | 20/88 (23%) | ||
iglon5 | NP_001017775.2 | IG_like | 33..123 | CDD:214653 | 22/94 (23%) |
Ig | 35..123 | CDD:299845 | 21/92 (23%) | ||
Ig | 125..>183 | CDD:299845 | 0/57 (0%) | ||
I-set | 128..207 | CDD:254352 | 5/78 (6%) | ||
IG_like | 217..298 | CDD:214653 | 23/97 (24%) | ||
ig | 223..296 | CDD:278476 | 23/91 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |