DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and FGFRL1

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_024309860.1 Gene:FGFRL1 / 53834 HGNCID:3693 Length:527 Species:Homo sapiens


Alignment Length:319 Identity:74/319 - (23%)
Similarity:116/319 - (36%) Gaps:100/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRK-RDLHILTAGILTYTSDERFKVVRT 167
            ||.:.|..:||.: .|.|.|..:.|.|:........|.:. |.:|         :...||:|:..
Human    51 PPKMADKVVPRQV-ARLGRTVRLQCPVEGDPPPLTMWTKDGRTIH---------SGWSRFRVLPQ 105

  Fly   168 ADSKDWTLHVKYAQPRDSGIYECQ-VNTEPKISMAFRLNVI--VTP------PDA---------- 213
            .      |.||..:..|:|:|.|: .|....:|:.:.|.|:  ::|      ||:          
Human   106 G------LKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPAS 164

  Fly   214 ---------------KAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILT-PF 262
                           :.:||.|      |||||.|.|     ..|......|.|.:....|| |.
Human   165 QQWARPRFTQPSKMRRRVIARP------VGSSVRLKC-----VASGHPRPDITWMKDDQALTRPE 218

  Fly   263 VAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTT---AEAASVVVNVI-NDE 323
            .|.|                 .|.:..|.:.|.:..|:|.|||..:.   |..|:..|:|| ...
Human   219 AAEP-----------------RKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTR 266

  Fly   324 SPAAMQKSRAIRTS---GSMRSSRLVLLLAMVASS---VVRWLIGGQRI--GSNSCHDS 374
            |...:..:..:.|:   |...|.:     ..|.|.   |::||   :|:  |:...|:|
Human   267 SKPVLTGTHPVNTTVDFGGTTSFQ-----CKVRSDVKPVIQWL---KRVEYGAEGRHNS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 23/94 (24%)
Ig 116..192 CDD:299845 18/77 (23%)
ig 220..306 CDD:278476 23/86 (27%)
IG_like 220..306 CDD:214653 23/86 (27%)
FGFRL1XP_024309860.1 I-set 56..139 CDD:254352 24/98 (24%)
Ig2_FGFRL1-like 180..261 CDD:143264 29/108 (27%)
Ig 284..378 CDD:325142 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.