DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr12

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:304 Identity:100/304 - (32%)
Similarity:162/304 - (53%) Gaps:44/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DNDYVYI---ASVNRKFPQFGNS-IDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAIN 127
            |||:..:   ..:|      |:| :|:..::.:.|..|.:..       |..|.|.:.|.||.:.
  Fly    47 DNDWKKLWMRGGIN------GDSKLDNNLDSSDSPMFEDSEL-------MAHNTTVQLGGTAFLV 98

  Fly   128 CR---VDNLGD--KSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGI 187
            |:   ||.:|.  ..:||||:||.|||::|...||:||||.::.|..|..|||.:|:.|.||.|:
  Fly    99 CKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGM 163

  Fly   188 YECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYW 252
            |||||:|...|...| :|:.|..|:  |.|.|..:|:|.:||::.|.|.:::..|..|   .:||
  Fly   164 YECQVSTPTGIISHF-VNLQVVVPE--AFILGSGELHVDMGSTINLVCIIEKSPTPPQ---YVYW 222

  Fly   253 YRGPYILTPFVAHPNDAAIDLQR-ISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVV 316
            .:...::.         .:|.:| |::|:|...:.||||.|...|:.|:|||||..:..|.||:.
  Fly   223 QKNDRLIN---------YVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIY 278

  Fly   317 VNVINDESPAAMQKSRAIRTSGSMRSS---RLVLLLAMVASSVV 357
            |.|...::.||:.:.   :||.:.|.:   |.:|...::.::||
  Fly   279 VFVSKGDNMAAISRR---KTSSADRLTHIFRSMLAPCLLLNTVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 43/97 (44%)
Ig 116..192 CDD:299845 37/80 (46%)
ig 220..306 CDD:278476 26/86 (30%)
IG_like 220..306 CDD:214653 26/86 (30%)
dpr12NP_652462.3 IG 86..183 CDD:214652 44/97 (45%)
Ig_3 193..271 CDD:404760 27/89 (30%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 3/3 (100%)
Ig strand F 264..269 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.