DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr9

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001005576.2 Gene:nitr9 / 449533 ZFINID:ZDB-GENE-041001-6 Length:285 Species:Danio rerio


Alignment Length:177 Identity:39/177 - (22%)
Similarity:66/177 - (37%) Gaps:47/177 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITTRTGHTAAINCRVDN---LGDKSVSW--IRKRD-------LHILTAGILTYTSDERFKVVRTA 168
            |.:.:|.:.::.|.|.|   :|:.|:.|  |..:|       .|........:.||..|:.:|..
Zfish   111 IPSHSGDSVSLTCTVLNQKCVGNHSMYWLIIESQDSPPRIISTHGTPVDQCEWISDADFRALRCV 175

  Fly   169 DS---KDWTLHVKYAQPRDSGIYECQVNT--EPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVG 228
            .|   ||:.|       .:|..|.|.|..  |.......:|::     ||.:    ..::.:.|.
Zfish   176 YSFSRKDFRL-------SNSATYSCTVTACGEKLDRNGSKLDI-----DADS----TEEMMILVL 224

  Fly   229 SSVTLTCHVKQPATSAQDIGPIYWY-----RGPYILTPFVAHPNDAA 270
            .|:..||.:.......     |.||     |    ::..|.:|:|.|
Zfish   225 LSIARTCLLLLVIVMV-----IIWYCVYSKR----ISKNVHYPSDVA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/106 (24%)
Ig 116..192 CDD:299845 22/90 (24%)
ig 220..306 CDD:278476 12/56 (21%)
IG_like 220..306 CDD:214653 12/56 (21%)
nitr9NP_001005576.2 IG_like 23..96 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.