DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr5

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:360 Identity:119/360 - (33%)
Similarity:181/360 - (50%) Gaps:65/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATPILVIMISISRAWTMQQQHLSPAIQQHPAVKSLSH--LVDGNDNLLPMVSAPSSIDNDYVYIA 74
            ::|::..:||.|||                  ..::|  ||:....||.::...:.:|..     
  Fly    19 SSPLIGKVISNSRA------------------PQIAHEMLVEYFMALLVIMGLTAPVDKQ----- 60

  Fly    75 SVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVS 139
              :|:..|:...:....|.....|:......||||....|.:....|.||.::|||.:|||::||
  Fly    61 --SRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVS 123

  Fly   140 WIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRL 204
            |||:|||||||.||:|||:|:||......:|.:|.|.:...|.||:|:|||||:||||||:|::|
  Fly   124 WIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKL 188

  Fly   205 NVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGP---IYWYRGPYILTPFVAHP 266
             |:||   :||.|....:|:::.||.:.|||      .:.|..||   :.|::...::       
  Fly   189 -VVVT---SKAQILANRELFIQSGSDINLTC------IAPQAPGPYTHMLWHKDTELV------- 236

  Fly   267 NDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKS 331
            :|:|....|:..|..:.   .|.|.|:..|..|:|||||....:.:.||.|::|..|..||||..
  Fly   237 SDSARGGIRVESEQQMK---TSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHE 298

  Fly   332 RAIRTSGSMRSSRLVL----LLAMVASSVVRWLIG 362
                     ..|||:|    ||.:....||  |:|
  Fly   299 ---------LGSRLLLPPLPLLLLAVLLVV--LLG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 50/92 (54%)
Ig 116..192 CDD:299845 39/75 (52%)
ig 220..306 CDD:278476 23/88 (26%)
IG_like 220..306 CDD:214653 23/88 (26%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 51/96 (53%)
IG_like 98..179 CDD:214653 42/80 (53%)
IG_like 206..278 CDD:214653 23/87 (26%)
Ig 211..278 CDD:143165 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444736
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.