DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and LSAMP

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:338 Identity:82/338 - (24%)
Similarity:129/338 - (38%) Gaps:90/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKY 179
            |||.|.|.||.:.|.|::...| |:|:.:..  |:.||...::.|.|.::.: ..|.:::|.::.
Human    40 NITVRQGDTAILRCVVEDKNSK-VAWLNRSG--IIFAGHDKWSLDPRVELEK-RHSLEYSLRIQK 100

  Fly   180 AQPRDSGIYECQVNT--EPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVK-QPA 241
            ....|.|.|.|.|.|  |||.|..:.  ::..||....|   .:|:.|..||:|||.|... :|.
Human   101 VDVYDEGSYTCSVQTQHEPKTSQVYL--IV
QVPPKISNI---SSDVTVNEGSNVTLVCMANGRPE 160

  Fly   242 TSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCM 306
                   |:..:|.   |||              ...|....|:....|.|...|   :|.|.|.
Human   161 -------PVITWRH---LTP--------------TGREFEGEEEYLEILGITREQ---SGKYECK 198

  Fly   307 P----TTAEAASVVVNVINDESPAAMQKSRAIR-TSGSMRSSRLVLLLAMVASSVVRWLIGGQRI 366
            .    ::|:...|.|.|   ..|..:.:|::.. |:|  |.:.|....:.|.:....|.....||
Human   199 AANEVSSADVKQVKVTV---NYPPTITESKSNEATTG--RQASLKCEASAVPAPDFEWYRDDTRI 258

  Fly   367 GSNS-----CHDSCSNLSTLHI------NY-CNLRAKI--------------------------T 393
            .|.:     ..:..|:|:..::      || |....|:                          |
Human   259 NSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPHPIQEIGTT 323

  Fly   394 SHLKEHRCLGPGS 406
            .|.|:.   ||||
Human   324 VHFKQK---GPGS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 29/92 (32%)
Ig 116..192 CDD:299845 22/75 (29%)
ig 220..306 CDD:278476 21/86 (24%)
IG_like 220..306 CDD:214653 21/86 (24%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 29/93 (31%)
Ig 132..215 CDD:386229 27/112 (24%)
Ig_3 219..294 CDD:372822 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.