DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and vstm2l

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_956790.2 Gene:vstm2l / 393468 ZFINID:ZDB-GENE-040426-1548 Length:187 Species:Danio rerio


Alignment Length:92 Identity:21/92 - (22%)
Similarity:43/92 - (46%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 PTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRG------PYILTPFVAHPNDAAIDLQRISM 278
            |.|::.:.|..|.::|..:..::|:..:...:||..      |:.....|:..| |:....:||:
Zfish    40 PADVFSRAGEDVEMSCSFRGSSSSSVSLEIQWWYSRQWAEPLPWATNQVVSQEN-ASKGATKISV 103

  Fly   279 ESTLAEKLQSRLRIANAQLLDTGNYTC 305
            ...:...:..:||::|.:..|.|.|.|
Zfish   104 VKVVGSNISHKLRLSNVKPSDEGTYEC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653
Ig 116..192 CDD:299845
ig 220..306 CDD:278476 21/92 (23%)
IG_like 220..306 CDD:214653 21/92 (23%)
vstm2lNP_956790.2 Ig <115..143 CDD:325142 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.