DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr10

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:400 Identity:125/400 - (31%)
Similarity:186/400 - (46%) Gaps:107/400 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SIDDEREAEEQPPEETTYPP-----------PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVS 139
            |.::...||.:|   |..||           |.||..||||||:..|.:|.:.|||.:||:|:|:
  Fly    25 SNNNHNNAEAKP---THAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVA 86

  Fly   140 WIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRL 204
            |||.|||||||.|..|||:|:||:.....|..:|||.:|:||.||:|:||||::|:|..|.:..|
  Fly    87 WIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNL 151

  Fly   205 NVI--------------------------------------------VTPPDAKAIIAGPTDLYV 225
            |::                                            |..|.| .|:.|| ||||
  Fly   152 NIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTA-TILGGP-DLYV 214

  Fly   226 KVGSSVTLTCHVK---QPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQ 287
            ..||::.|||.:|   :|.|.      |:||....:|:...:.        .|:..::..:|:.:
  Fly   215 DKGSTINLTCIIKFSPEPPTH------IFWYHQDKVLSEETSG--------GRLKFKTIKSEETK 265

  Fly   288 SRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAM-------------------QKSRA 333
            |.|.|.:|.||.:|.|:|.|:..|.||:.|:|:..|.|.||                   |.::|
  Fly   266 SILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQA 330

  Fly   334 IRTSGSMRSSRLVLLLAMVASSVVRWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAK-ITSHLK 397
            :|...:|.:: ||||.|  .||::.     |..|...|....|....:......:|.| :|:.|.
  Fly   331 VRVISTMVAA-LVLLEA--CSSLLL-----QSGGGGGCPGGGSPAGGMPTRVREIREKPLTNSLL 387

  Fly   398 EHRCLGPGST 407
            :.:.  |.:|
  Fly   388 DPKI--PSTT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 49/92 (53%)
Ig 116..192 CDD:299845 41/75 (55%)
ig 220..306 CDD:278476 27/88 (31%)
IG_like 220..306 CDD:214653 27/88 (31%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 43/79 (54%)
IG_like 210..297 CDD:214653 33/101 (33%)
IGc2 217..287 CDD:197706 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444672
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.