DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr13

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:351 Identity:111/351 - (31%)
Similarity:174/351 - (49%) Gaps:56/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QQHLSPAIQQHPAVKSLSH-LVDGNDNLLPMVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREA 93
            |...:|...|...:::.|| .:...|...|             |...|:|..|     :::..||
  Fly   113 QSQPTPTHLQEAVLQTHSHSRIQAKDTAGP-------------YPIPVHRPEP-----VENHLEA 159

  Fly    94 EE--QPPEETTYPPPVFDFGMPRN--ITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGIL 154
            ..  :...|:.:..|:: ||...:  :||:.|.||.:.|.|.::|:..||||||:|.|:||.|:.
  Fly   160 NNGIEGGMESLFGTPMY-FGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLT 223

  Fly   155 TYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAG 219
            ||:|||||.......|:||||.:|:.|.||:|:|||||:|.|..|:...|:|:    :|:|.|.|
  Fly   224 TYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVV----EARAEITG 284

  Fly   220 PTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAA-IDLQRISMESTLA 283
            |...|:..||::.|.|.|.| .|.|.:.  |:||           |.|... .|:.|....||..
  Fly   285 PPIRYLTPGSTLRLQCRVVQ-NTEASEY--IFWY-----------HDNRMINYDIDRGINVSTEP 335

  Fly   284 EKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRS--SRLV 346
            :...|.|.|...:...:||:||:.:..:.|||:|::...::||||...   ...||.::  |:|.
  Fly   336 DFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHG---HVGGSTKTTQSQLH 397

  Fly   347 LLLAMVASSVVRWLIGGQRIGSNSCH 372
            :::.::||        |.||...|.:
  Fly   398 MIMIIIAS--------GYRIFHTSVY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 45/94 (48%)
Ig 116..192 CDD:299845 39/75 (52%)
ig 220..306 CDD:278476 25/86 (29%)
IG_like 220..306 CDD:214653 25/86 (29%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 45/95 (47%)
IG_like 182..262 CDD:214653 40/79 (51%)
IG_like 285..362 CDD:214653 26/90 (29%)
IGc2 292..361 CDD:197706 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.