DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Gm1123

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001074245.1 Gene:Gm1123 / 382097 MGIID:2685969 Length:390 Species:Mus musculus


Alignment Length:267 Identity:61/267 - (22%)
Similarity:104/267 - (38%) Gaps:69/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 YIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDK 136
            ||.||         ||....:..|:...||.:.|.:|.|               |:   .:.|..
Mouse   141 YIGSV---------SITTPEQTIEKDQGETVHLPCMFTF---------------IS---KDQGPL 178

  Fly   137 SVSWIR-------KRDLHILTAGILTYTSDE---------RFKVVRTAD---SKDWTLHVKYAQP 182
            ::.|:|       ..| |:    ::.|::|:         :.:|..|::   |.|.::::...|.
Mouse   179 NIEWLRLSGPNNEAMD-HV----VILYSADKIHDDVYPDLKGRVYFTSNDIKSGDASINITNVQL 238

  Fly   183 RDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKV-GSSVTLTCHVKQPATSAQD 246
            .|:|.|:|:|.|.|. ::...|.:.||.......|..|.....|. |.:|.|.|..   ..|.:|
Mouse   239 SDAGTYQCKVKTYPG-TVNRNLQLAVTDHIGSVSITTPEQTIQKARGETVHLPCTF---TLSPED 299

  Fly   247 IGPIY--WYR--GP---YILTPFVAHPNDAAID------LQRISMESTLAEKLQSRLRIANAQLL 298
            .||::  |.:  ||   .:...|:.:..|...|      ..|:...|......::.:.|.:|:|.
Mouse   300 HGPLFIDWMQLTGPQNEVVNRMFIVYLADKIYDNFYQDMKGRVQFTSNDIRSGEASINITDARLS 364

  Fly   299 DTGNYTC 305
            |.|.|.|
Mouse   365 DAGTYQC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 21/111 (19%)
Ig 116..192 CDD:299845 17/94 (18%)
ig 220..306 CDD:278476 25/100 (25%)
IG_like 220..306 CDD:214653 25/100 (25%)
Gm1123NP_001074245.1 V-set 24..139 CDD:284989
IG_like 25..138 CDD:214653
V-set 149..264 CDD:284989 27/138 (20%)
IG_like 152..263 CDD:214653 27/134 (20%)
V-set 274..389 CDD:284989 25/101 (25%)
IG_like 277..388 CDD:214653 24/98 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.