DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Gm5150

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001075156.1 Gene:Gm5150 / 381484 MGIID:3779469 Length:299 Species:Mus musculus


Alignment Length:289 Identity:65/289 - (22%)
Similarity:113/289 - (39%) Gaps:87/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RNITTRTGHTAAINCRVDNL---GDKSVSWIR----KRDLHILTAGILTYTSDERFKVVRTADSK 171
            ::::.|.|.:|.:||.|.:|   |  .:.|.|    :|:|      |.:||.:...::...:|:.
Mouse    38 KSVSVRAGGSATLNCTVTSLLPVG--PIRWYRGVGHRRNL------IYSYTGEHFPRITNVSDTT 94

  Fly   172 -----DWTLHVKYAQPRDSGIYEC----QVNTEPKISM----AFRLNVIVTPPDAKAIIAGPTDL 223
                 |:::.:.|....|:|.|.|    :..:||.|.:    ...|.|:........:|.....:
Mouse    95 NRRNLDFSICISYVTFADAGTYYCVKFQKGPSEPDIEIQSGGGTELFVL
GAAGKELKVIQPEKSV 159

  Fly   224 YVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGP-------YILT----PFVAHPNDAAIDLQRIS 277
            .|:.|...||.|.|    ||...:||:.||||.       |..|    |.:.:.:||        
Mouse   160 SVRAGGLATLNCTV----TSLIPVGPMRWYRGVGHRRNLIYSYTGEHFPRITNVSDA-------- 212

  Fly   278 MESTLAEKLQSRLRIANAQLLDTGNYTCM-----PTTAEAASVVVNVINDESPAAMQKSRA---- 333
               |....|...:||::....|...|.|:     |:              ||...:|....    
Mouse   213 ---TKRRNLDFSIRISDVTFADADTYYCVKFQKGPS--------------ESDIEIQSGGGTELL 260

  Fly   334 ---IRTSGSMR-------SSRLVLLLAMV 352
               ::|||:.:       .|:|:|.:|::
Mouse   261 VLELKTSGNAKILAAVLLGSKLLLAIAVI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 26/111 (23%)
Ig 116..192 CDD:299845 22/91 (24%)
ig 220..306 CDD:278476 25/96 (26%)
IG_like 220..306 CDD:214653 25/96 (26%)
Gm5150NP_001075156.1 Ig 32..143 CDD:386229 26/112 (23%)
Ig 151..262 CDD:386229 31/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12440
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.