DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr20

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:362 Identity:92/362 - (25%)
Similarity:156/362 - (43%) Gaps:74/362 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IATPILVIMISISRAWTMQQQHLSPAIQQHPAVK--SLSHLVDGNDNLLPMVSAPSSIDNDYVYI 73
            :|||            |...::.|..:.::.|||  |...|..|.....||:        :|:: 
  Fly   204 LATP------------TEPARNRSTGLVRNSAVKVDSKHPLSKGQKTDAPML--------NYIF- 247

  Fly    74 ASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFD---FGMPRNITTRTGHTAAINCRVDNLGD 135
                          |....|.:....:..|.|...|   .|...|:|.:.|.:..:|||:..|.|
  Fly   248 --------------DTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQD 298

  Fly   136 KSVSWIRKRD----------LHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYEC 190
            |:|||:|...          |.:||.|:.|||.|:|:| :......:|.|.:...:..|..||||
  Fly   299 KTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYK-MEFQYPNNWRLKITNVKKDDEAIYEC 362

  Fly   191 QVNTEPKISMAFRLNVIVTPPDAKAI--IAGP-TDLYVKVGSSVTLTCHVKQPATSAQDIGPIYW 252
            |::|.|  ....::|:.|..|....:  :..| .:.|.::.|::.|:|.|:..|.::   ..::|
  Fly   363 QISTHP--PRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTS---SVVFW 422

  Fly   253 YRGPYILTPFVAHPNDAAIDLQR--ISMESTLAEK-LQSRLRIANAQLLDTGNYTCMPTTAEAAS 314
            .....||.          .|:.|  :|:::.|.|. ..|.|.||.....|:|||||..:..:..:
  Fly   423 KHMDNILN----------YDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFT 477

  Fly   315 VVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAM 351
            :||:::|.||.|.:....|:....:..:  :|:|.||
  Fly   478 IVVHILNGESFAELHHGGAVGWHSTWWN--MVMLHAM 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 33/102 (32%)
Ig 116..192 CDD:299845 29/85 (34%)
ig 220..306 CDD:278476 24/89 (27%)
IG_like 220..306 CDD:214653 24/89 (27%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 31/87 (36%)
Ig 279..378 CDD:299845 33/101 (33%)
Ig 400..471 CDD:299845 23/83 (28%)
IG_like 402..480 CDD:214653 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444715
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.