DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr2 and nitr1h

DIOPT Version :9

Sequence 1:	NP_001014480.4	Gene:	dpr2 / 3346227	FlyBaseID:	FBgn0261871	Length:	410	Species:	Drosophila melanogaster
Sequence 2:	NP_001011884.1	Gene:	nitr1h / 368781	ZFINID:	ZDB-GENE-041001-84	Length:	339	Species:	Danio rerio

Alignment Length:	131	Identity:	34/131 - (25%)
Similarity:	57/131 - (43%)	Gaps:	15/131 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   120 TGHTAAINCRV---DNLGDKSVSWIRKRDLHILTAGILTYTSDER-FKVVRTADSKD----WTLH 176
            :|.:..:.|.:   ...||.||.|.::  :...:.|:| ||..|| .:...:.:|:.    ::||
Zfish   165 SGDSVYLQCSIFTESCAGDHSVYWFKQ--ISGDSEGVL-YTKGERNGRCKNSTESQTQSCVYSLH 226

  Fly   177 VKYAQPRDSGIYECQVNT--EPKISMAFRLNVIVTPPDAKAIIA-GPTD-LYVKVGSSVTLTCHV 237
            .......|||||.|.|..  |.......:||:.....:...:|| |..: |::.....||:..|.
Zfish   227 KNNISRSDSGIYYCAVAACGEILFGRGTQLNIKECNDENPTLIALGILNILFLAYAVFVTVKLHN 291

  Fly   238 K 238
            |
Zfish   292 K 292

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr2	NP_001014480.4	IG_like	113..206	CDD:214653	25/95 (26%)
		Ig	116..192	CDD:299845	22/79 (28%)
		ig	220..306	CDD:278476	5/20 (25%)
		IG_like	220..306	CDD:214653	5/20 (25%)
nitr1h	NP_001011884.1	V-set	45..145	CDD:284989
		IG_like	45..144	CDD:214653
		IG_like	163..242	CDD:214653	22/79 (28%)
		V-set	166..258	CDD:284989	25/94 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1457433at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010